Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1G1G5

Protein Details
Accession C1G1G5   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-50LEPRRNKLKIGTRIKQRRPTYAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.5, nucl 4, extr 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017946  PLC-like_Pdiesterase_TIM-brl  
Gene Ontology GO:0008081  F:phosphoric diester hydrolase activity  
GO:0006629  P:lipid metabolic process  
KEGG pbn:PADG_00705  -  
CDD cd08576  GDPD_like_SMaseD_PLD  
Amino Acid Sequences MQPLTSTICALFCLLLTLPLTFGSPFELEPRRNKLKIGTRIKQRRPTYAIAHMVLDKTGVKDAIKHGANALEIDVAAYREGWWADHDMKAKSKGWSVESLFQVIAKENKHIAFVWLDLKTPDMCTGKKCNKKSLQQLTRKYLKPAGVRVLFGFYKKHHARSAAFDYIQKSLGDGEAVCLSGEANKVMEIFKKEGSKIKPQRRVMDYGRTELPNGFGDCNEKGGKTCAELKNGAKLRQRGDLQRVFAWTSHVGEGKYVNKLLDKASVDGIIYGFAKTRYYHHKDTEKSSKDIIDRVKKSKSRYMATGADKLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.11
5 0.11
6 0.11
7 0.12
8 0.1
9 0.1
10 0.11
11 0.11
12 0.12
13 0.18
14 0.24
15 0.28
16 0.35
17 0.44
18 0.49
19 0.49
20 0.5
21 0.53
22 0.57
23 0.63
24 0.66
25 0.66
26 0.69
27 0.79
28 0.86
29 0.87
30 0.82
31 0.8
32 0.76
33 0.73
34 0.69
35 0.66
36 0.62
37 0.54
38 0.5
39 0.43
40 0.37
41 0.3
42 0.25
43 0.17
44 0.13
45 0.13
46 0.13
47 0.11
48 0.14
49 0.17
50 0.24
51 0.24
52 0.23
53 0.23
54 0.23
55 0.23
56 0.21
57 0.18
58 0.1
59 0.09
60 0.09
61 0.08
62 0.07
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.12
71 0.14
72 0.17
73 0.2
74 0.21
75 0.25
76 0.29
77 0.31
78 0.29
79 0.31
80 0.3
81 0.29
82 0.33
83 0.33
84 0.35
85 0.33
86 0.32
87 0.28
88 0.25
89 0.23
90 0.19
91 0.19
92 0.14
93 0.15
94 0.16
95 0.17
96 0.17
97 0.17
98 0.17
99 0.14
100 0.15
101 0.17
102 0.14
103 0.14
104 0.13
105 0.14
106 0.13
107 0.13
108 0.16
109 0.14
110 0.15
111 0.18
112 0.28
113 0.36
114 0.44
115 0.46
116 0.51
117 0.57
118 0.64
119 0.7
120 0.72
121 0.73
122 0.74
123 0.78
124 0.76
125 0.76
126 0.7
127 0.62
128 0.55
129 0.51
130 0.45
131 0.41
132 0.41
133 0.34
134 0.33
135 0.3
136 0.29
137 0.24
138 0.22
139 0.2
140 0.13
141 0.22
142 0.23
143 0.26
144 0.25
145 0.28
146 0.29
147 0.34
148 0.39
149 0.33
150 0.32
151 0.3
152 0.3
153 0.27
154 0.27
155 0.2
156 0.14
157 0.11
158 0.1
159 0.09
160 0.07
161 0.07
162 0.06
163 0.06
164 0.06
165 0.05
166 0.05
167 0.06
168 0.07
169 0.06
170 0.05
171 0.06
172 0.06
173 0.07
174 0.1
175 0.11
176 0.13
177 0.16
178 0.18
179 0.19
180 0.26
181 0.29
182 0.38
183 0.45
184 0.53
185 0.6
186 0.63
187 0.7
188 0.67
189 0.7
190 0.64
191 0.64
192 0.56
193 0.5
194 0.49
195 0.41
196 0.38
197 0.31
198 0.29
199 0.21
200 0.2
201 0.17
202 0.14
203 0.16
204 0.16
205 0.19
206 0.17
207 0.15
208 0.14
209 0.17
210 0.17
211 0.17
212 0.25
213 0.25
214 0.28
215 0.33
216 0.33
217 0.4
218 0.44
219 0.48
220 0.45
221 0.47
222 0.46
223 0.49
224 0.53
225 0.5
226 0.54
227 0.53
228 0.49
229 0.47
230 0.46
231 0.4
232 0.36
233 0.33
234 0.25
235 0.22
236 0.21
237 0.22
238 0.19
239 0.19
240 0.22
241 0.21
242 0.23
243 0.22
244 0.21
245 0.21
246 0.22
247 0.22
248 0.25
249 0.24
250 0.22
251 0.22
252 0.22
253 0.2
254 0.19
255 0.18
256 0.13
257 0.11
258 0.1
259 0.1
260 0.1
261 0.12
262 0.12
263 0.18
264 0.26
265 0.34
266 0.41
267 0.48
268 0.57
269 0.6
270 0.69
271 0.74
272 0.69
273 0.65
274 0.61
275 0.58
276 0.52
277 0.53
278 0.54
279 0.54
280 0.55
281 0.58
282 0.65
283 0.65
284 0.69
285 0.71
286 0.7
287 0.66
288 0.64
289 0.65
290 0.63
291 0.64