Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BGN1

Protein Details
Accession A0A1E3BGN1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-39ASPQEPTTLKRPPRRPRPETPGKAIQAHydrophilic
NLS Segment(s)
PositionSequence
22-31KRPPRRPRPE
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGEAPGAHETLTASPQEPTTLKRPPRRPRPETPGKAIQAPPTPKNWHPDRDTPPASPSYKAPQSQLGLELQSHITAAVASRTAQLKTTGDEVLELVSVISQKVANWEEKSLQGAASLGKDIRTLVLNFSRNLATGHPTKQENHQPPHSKHNSYAKATRTPPNVPKTQLKIPKTTHKSPQSEKTPRIFLHLPKDLSQAAPVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.17
4 0.17
5 0.2
6 0.25
7 0.33
8 0.41
9 0.5
10 0.6
11 0.67
12 0.77
13 0.83
14 0.85
15 0.86
16 0.87
17 0.89
18 0.86
19 0.83
20 0.81
21 0.72
22 0.7
23 0.62
24 0.58
25 0.55
26 0.53
27 0.47
28 0.45
29 0.48
30 0.45
31 0.51
32 0.51
33 0.51
34 0.51
35 0.57
36 0.58
37 0.61
38 0.62
39 0.55
40 0.52
41 0.5
42 0.46
43 0.38
44 0.34
45 0.32
46 0.35
47 0.35
48 0.33
49 0.33
50 0.32
51 0.32
52 0.31
53 0.24
54 0.19
55 0.17
56 0.17
57 0.12
58 0.1
59 0.09
60 0.07
61 0.06
62 0.05
63 0.05
64 0.04
65 0.05
66 0.05
67 0.07
68 0.09
69 0.09
70 0.1
71 0.12
72 0.12
73 0.13
74 0.14
75 0.12
76 0.11
77 0.11
78 0.1
79 0.08
80 0.07
81 0.06
82 0.04
83 0.04
84 0.04
85 0.03
86 0.04
87 0.04
88 0.04
89 0.07
90 0.09
91 0.11
92 0.12
93 0.13
94 0.14
95 0.14
96 0.16
97 0.13
98 0.11
99 0.09
100 0.09
101 0.08
102 0.07
103 0.08
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.08
110 0.08
111 0.11
112 0.17
113 0.18
114 0.19
115 0.2
116 0.2
117 0.18
118 0.19
119 0.17
120 0.15
121 0.16
122 0.19
123 0.21
124 0.23
125 0.24
126 0.3
127 0.39
128 0.44
129 0.47
130 0.53
131 0.58
132 0.59
133 0.69
134 0.69
135 0.61
136 0.59
137 0.63
138 0.61
139 0.58
140 0.61
141 0.55
142 0.56
143 0.58
144 0.58
145 0.53
146 0.54
147 0.57
148 0.58
149 0.58
150 0.56
151 0.59
152 0.59
153 0.63
154 0.64
155 0.6
156 0.61
157 0.62
158 0.68
159 0.68
160 0.69
161 0.69
162 0.7
163 0.74
164 0.74
165 0.77
166 0.77
167 0.78
168 0.78
169 0.74
170 0.73
171 0.65
172 0.65
173 0.6
174 0.56
175 0.56
176 0.58
177 0.54
178 0.48
179 0.52
180 0.46
181 0.41