Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3B9A3

Protein Details
Accession A0A1E3B9A3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-38TASPQEPTTPKRPPKRLRPETPGKAIQHydrophilic
NLS Segment(s)
PositionSequence
22-30KRPPKRLRP
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2
Family & Domain DBs
Amino Acid Sequences MGEALGAHETLTASPQEPTTPKRPPKRLRPETPGKAIQAPPMPKNWHPDQDTPPVSPSYEAPQSHIAAAVASRTAQLKTTGDEVLELVFVISQKVANWKEKSLQGAASLGKDIRTLVLNFSRNLATAHPTKQENHQPLHSKHNSYAEATRTSPNVPKTQLKIPKITHKSPQSEKTPCIFLHLPKDHPAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.15
4 0.19
5 0.25
6 0.31
7 0.4
8 0.49
9 0.58
10 0.68
11 0.74
12 0.81
13 0.87
14 0.89
15 0.89
16 0.89
17 0.89
18 0.87
19 0.85
20 0.78
21 0.7
22 0.65
23 0.56
24 0.52
25 0.49
26 0.45
27 0.39
28 0.41
29 0.43
30 0.4
31 0.46
32 0.46
33 0.46
34 0.47
35 0.51
36 0.5
37 0.54
38 0.54
39 0.48
40 0.44
41 0.37
42 0.33
43 0.27
44 0.23
45 0.18
46 0.22
47 0.21
48 0.22
49 0.25
50 0.25
51 0.24
52 0.23
53 0.18
54 0.12
55 0.12
56 0.09
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.09
64 0.1
65 0.11
66 0.13
67 0.12
68 0.11
69 0.11
70 0.1
71 0.08
72 0.07
73 0.06
74 0.04
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.04
81 0.1
82 0.13
83 0.18
84 0.2
85 0.21
86 0.24
87 0.26
88 0.28
89 0.23
90 0.22
91 0.16
92 0.17
93 0.16
94 0.14
95 0.12
96 0.1
97 0.09
98 0.09
99 0.08
100 0.07
101 0.08
102 0.08
103 0.11
104 0.17
105 0.18
106 0.18
107 0.2
108 0.2
109 0.18
110 0.19
111 0.16
112 0.14
113 0.16
114 0.18
115 0.21
116 0.23
117 0.24
118 0.3
119 0.38
120 0.39
121 0.4
122 0.44
123 0.48
124 0.49
125 0.58
126 0.56
127 0.5
128 0.48
129 0.52
130 0.47
131 0.41
132 0.43
133 0.36
134 0.35
135 0.34
136 0.32
137 0.27
138 0.28
139 0.31
140 0.31
141 0.32
142 0.34
143 0.39
144 0.41
145 0.49
146 0.55
147 0.54
148 0.58
149 0.59
150 0.65
151 0.66
152 0.67
153 0.66
154 0.66
155 0.71
156 0.71
157 0.73
158 0.71
159 0.7
160 0.69
161 0.64
162 0.6
163 0.52
164 0.51
165 0.46
166 0.42
167 0.47
168 0.48
169 0.47