Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3BJR7

Protein Details
Accession A0A1E3BJR7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
92-111SGRTAICRCQVKRRARKVLLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023112  Antifungal-protein_dom_sf  
IPR022706  Antifungal_prot  
Gene Ontology GO:0050832  P:defense response to fungus  
Pfam View protein in Pfam  
PF11402  Antifungal_prot  
Amino Acid Sequences MKLTLLTSLGFALFTALGAVASPVDFDSNSLDVRDEAIEASAAEANVFDEASIADEAGEVDVTAEDGEAGTLIRYDGTCSNRNNQCRYRAQSGRTAICRCQVKRRARKVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.08
15 0.1
16 0.1
17 0.1
18 0.11
19 0.1
20 0.11
21 0.11
22 0.08
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.03
37 0.03
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.02
47 0.02
48 0.02
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.03
60 0.03
61 0.04
62 0.06
63 0.1
64 0.15
65 0.21
66 0.23
67 0.32
68 0.39
69 0.45
70 0.51
71 0.52
72 0.55
73 0.58
74 0.63
75 0.64
76 0.63
77 0.61
78 0.62
79 0.63
80 0.63
81 0.61
82 0.58
83 0.51
84 0.52
85 0.57
86 0.53
87 0.56
88 0.58
89 0.62
90 0.69
91 0.78