Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BB30

Protein Details
Accession A0A1E3BB30    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-39QGDRTTQEQIRKRRHNLFKRLKEFNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MGGPSKIGKAYRVQGDRTTQEQIRKRRHNLFKRLKEFNDRYEIDIWLTMRMPSGRIYTFATDPNEPIPSDEEIQGNNVPVIHKTPADYVGKNGAPPSATPLRDPPSLPFLDLPFCVAHIEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.51
4 0.48
5 0.47
6 0.42
7 0.46
8 0.51
9 0.56
10 0.6
11 0.65
12 0.69
13 0.74
14 0.81
15 0.82
16 0.85
17 0.87
18 0.87
19 0.85
20 0.85
21 0.78
22 0.78
23 0.72
24 0.65
25 0.63
26 0.53
27 0.48
28 0.42
29 0.38
30 0.28
31 0.26
32 0.21
33 0.14
34 0.13
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.12
41 0.11
42 0.12
43 0.14
44 0.15
45 0.16
46 0.18
47 0.18
48 0.16
49 0.16
50 0.16
51 0.15
52 0.13
53 0.13
54 0.12
55 0.12
56 0.13
57 0.13
58 0.13
59 0.12
60 0.14
61 0.14
62 0.12
63 0.1
64 0.09
65 0.09
66 0.09
67 0.11
68 0.1
69 0.1
70 0.11
71 0.13
72 0.17
73 0.2
74 0.2
75 0.2
76 0.25
77 0.25
78 0.24
79 0.23
80 0.19
81 0.16
82 0.16
83 0.21
84 0.22
85 0.22
86 0.23
87 0.29
88 0.33
89 0.35
90 0.36
91 0.33
92 0.33
93 0.33
94 0.32
95 0.28
96 0.25
97 0.26
98 0.25
99 0.23
100 0.17
101 0.16
102 0.16