Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C1CFJ7

Protein Details
Accession A0A1C1CFJ7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
495-520AGWSRSLRYAREKRAKAKKGAQAQSDHydrophilic
NLS Segment(s)
PositionSequence
504-515AREKRAKAKKGA
Subcellular Location(s) mito 13.5, cyto_mito 9.5, nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015222  Tam41  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0004605  F:phosphatidate cytidylyltransferase activity  
GO:0032049  P:cardiolipin biosynthetic process  
GO:0016024  P:CDP-diacylglycerol biosynthetic process  
Pfam View protein in Pfam  
PF09139  Tam41_Mmp37  
Amino Acid Sequences MTLRVVPSVLGKRGLTEVYGSPLVSTIRRLPLSTGIRFYATVEEDRARSDGPPPGFDAGKAKQSPNENPSKQSTPATGSRSSDKKLSADGSSKPSSTTSGTTDWEENPDLSISKFSELPSRDFGVNQHIIINEEFKEALRQILWKFRAPIRYAFAYGSGVFPQSSGGSGSGGSSKLHPNPPEAVAKVQDGNQKMIDFIFGVSYTQHWHSLNLQDNRDHYSWVGSLGSYAVTKIQDSIGAGVYFNPYITVNGTLIKYGVVNLDTLCRDLSEWDTLYLAGRLQKPVKILRDNPAVRLANQVNLIAAVRTALLLLPPEFTEKELYSTIAGISYMGDPRMTIGGDDPRKVQNIVTHQLPNFRRLYAPLIDNLPNITFNDPACSDRDWLNDPNVNAKLAQNMDPVTRGHMVRRLPNAFRHKLYFEYQSKFKIPRGEFNKMLEETKDEDPDRIRRREGGPFEQRIAQDTEGGGLREEVKQVIEHTVRWPSFMQSLKGPITAGWSRSLRYAREKRAKAKKGAQAQSDDAKEKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.25
3 0.22
4 0.2
5 0.21
6 0.22
7 0.2
8 0.17
9 0.19
10 0.2
11 0.18
12 0.2
13 0.21
14 0.27
15 0.28
16 0.29
17 0.3
18 0.38
19 0.44
20 0.44
21 0.42
22 0.36
23 0.36
24 0.36
25 0.34
26 0.3
27 0.26
28 0.24
29 0.24
30 0.25
31 0.24
32 0.26
33 0.26
34 0.21
35 0.2
36 0.22
37 0.26
38 0.25
39 0.26
40 0.27
41 0.29
42 0.28
43 0.28
44 0.31
45 0.27
46 0.33
47 0.34
48 0.33
49 0.35
50 0.42
51 0.49
52 0.5
53 0.58
54 0.52
55 0.54
56 0.59
57 0.58
58 0.54
59 0.49
60 0.44
61 0.39
62 0.43
63 0.43
64 0.4
65 0.39
66 0.43
67 0.45
68 0.44
69 0.43
70 0.39
71 0.36
72 0.36
73 0.36
74 0.33
75 0.33
76 0.35
77 0.37
78 0.37
79 0.36
80 0.32
81 0.3
82 0.28
83 0.26
84 0.24
85 0.21
86 0.21
87 0.23
88 0.25
89 0.26
90 0.25
91 0.26
92 0.25
93 0.21
94 0.19
95 0.18
96 0.16
97 0.14
98 0.16
99 0.13
100 0.13
101 0.14
102 0.14
103 0.2
104 0.22
105 0.25
106 0.27
107 0.28
108 0.27
109 0.27
110 0.27
111 0.28
112 0.28
113 0.24
114 0.22
115 0.19
116 0.21
117 0.21
118 0.21
119 0.14
120 0.13
121 0.13
122 0.11
123 0.14
124 0.12
125 0.13
126 0.12
127 0.15
128 0.16
129 0.25
130 0.27
131 0.28
132 0.32
133 0.35
134 0.41
135 0.4
136 0.42
137 0.39
138 0.38
139 0.37
140 0.33
141 0.3
142 0.25
143 0.22
144 0.19
145 0.14
146 0.12
147 0.1
148 0.1
149 0.1
150 0.08
151 0.08
152 0.08
153 0.07
154 0.07
155 0.07
156 0.08
157 0.08
158 0.09
159 0.09
160 0.1
161 0.14
162 0.18
163 0.24
164 0.24
165 0.26
166 0.28
167 0.3
168 0.32
169 0.29
170 0.26
171 0.22
172 0.23
173 0.21
174 0.22
175 0.24
176 0.21
177 0.22
178 0.22
179 0.2
180 0.19
181 0.18
182 0.14
183 0.1
184 0.08
185 0.07
186 0.06
187 0.06
188 0.06
189 0.06
190 0.08
191 0.09
192 0.12
193 0.12
194 0.13
195 0.15
196 0.21
197 0.29
198 0.32
199 0.33
200 0.32
201 0.33
202 0.37
203 0.34
204 0.29
205 0.2
206 0.17
207 0.15
208 0.14
209 0.13
210 0.08
211 0.07
212 0.07
213 0.07
214 0.05
215 0.05
216 0.06
217 0.06
218 0.06
219 0.07
220 0.07
221 0.07
222 0.07
223 0.08
224 0.08
225 0.08
226 0.08
227 0.07
228 0.08
229 0.07
230 0.07
231 0.06
232 0.05
233 0.06
234 0.06
235 0.07
236 0.07
237 0.09
238 0.09
239 0.08
240 0.08
241 0.08
242 0.07
243 0.06
244 0.07
245 0.05
246 0.05
247 0.05
248 0.07
249 0.07
250 0.08
251 0.07
252 0.07
253 0.07
254 0.07
255 0.09
256 0.09
257 0.09
258 0.09
259 0.09
260 0.09
261 0.1
262 0.09
263 0.08
264 0.1
265 0.11
266 0.14
267 0.15
268 0.16
269 0.19
270 0.24
271 0.29
272 0.3
273 0.32
274 0.35
275 0.44
276 0.43
277 0.42
278 0.44
279 0.39
280 0.34
281 0.37
282 0.31
283 0.24
284 0.24
285 0.22
286 0.14
287 0.14
288 0.14
289 0.07
290 0.07
291 0.04
292 0.04
293 0.03
294 0.04
295 0.03
296 0.03
297 0.04
298 0.05
299 0.05
300 0.06
301 0.08
302 0.08
303 0.09
304 0.12
305 0.11
306 0.13
307 0.13
308 0.13
309 0.12
310 0.12
311 0.11
312 0.08
313 0.08
314 0.05
315 0.06
316 0.06
317 0.07
318 0.07
319 0.06
320 0.06
321 0.07
322 0.08
323 0.07
324 0.06
325 0.08
326 0.15
327 0.18
328 0.19
329 0.2
330 0.22
331 0.23
332 0.24
333 0.23
334 0.2
335 0.24
336 0.27
337 0.28
338 0.3
339 0.29
340 0.37
341 0.37
342 0.37
343 0.32
344 0.3
345 0.27
346 0.25
347 0.29
348 0.24
349 0.24
350 0.21
351 0.24
352 0.24
353 0.23
354 0.22
355 0.18
356 0.15
357 0.15
358 0.14
359 0.12
360 0.11
361 0.14
362 0.14
363 0.15
364 0.16
365 0.17
366 0.17
367 0.18
368 0.21
369 0.22
370 0.24
371 0.28
372 0.28
373 0.27
374 0.32
375 0.31
376 0.28
377 0.24
378 0.22
379 0.22
380 0.21
381 0.23
382 0.19
383 0.19
384 0.19
385 0.2
386 0.2
387 0.19
388 0.2
389 0.19
390 0.2
391 0.24
392 0.27
393 0.32
394 0.39
395 0.41
396 0.41
397 0.5
398 0.56
399 0.56
400 0.56
401 0.54
402 0.48
403 0.47
404 0.47
405 0.48
406 0.45
407 0.45
408 0.45
409 0.46
410 0.49
411 0.48
412 0.48
413 0.48
414 0.44
415 0.48
416 0.53
417 0.55
418 0.54
419 0.54
420 0.58
421 0.5
422 0.49
423 0.4
424 0.35
425 0.32
426 0.32
427 0.34
428 0.27
429 0.29
430 0.32
431 0.41
432 0.46
433 0.46
434 0.46
435 0.45
436 0.49
437 0.56
438 0.58
439 0.58
440 0.59
441 0.59
442 0.59
443 0.58
444 0.54
445 0.48
446 0.45
447 0.35
448 0.27
449 0.23
450 0.23
451 0.19
452 0.2
453 0.16
454 0.13
455 0.15
456 0.14
457 0.15
458 0.13
459 0.13
460 0.13
461 0.15
462 0.21
463 0.21
464 0.21
465 0.25
466 0.33
467 0.32
468 0.33
469 0.33
470 0.28
471 0.33
472 0.36
473 0.34
474 0.29
475 0.35
476 0.35
477 0.35
478 0.32
479 0.25
480 0.29
481 0.29
482 0.27
483 0.28
484 0.28
485 0.28
486 0.34
487 0.39
488 0.37
489 0.44
490 0.53
491 0.57
492 0.66
493 0.73
494 0.77
495 0.83
496 0.87
497 0.86
498 0.86
499 0.84
500 0.84
501 0.84
502 0.8
503 0.74
504 0.71
505 0.69
506 0.65
507 0.61