Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CPM4

Protein Details
Accession A0A1C1CPM4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-56SKLDRDTRTSHRPSQRRRSSTQPPESAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003903  UIM_dom  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS50330  UIM  
PS01359  ZF_PHD_1  
Amino Acid Sequences MSPRRSSRARSSQQPPPAPNHTNSNTSTISKLDRDTRTSHRPSQRRRSSTQPPESADGADSSSRAEQAAPRRSRRNGEDKEPVIKQPLEDEENDIEAADEEITRCICGQAEYPGPPFALVRRLVGPDDSVEETGNFFVQCDNCGVWQHGGCMGIIDEVFLPDEYFCEQCKPELHKIVRSSSGPKSSRYIPLLDASSRRSSPLSSNPEAGRKKDSKSAQSEITKRRATMNSRVAYDEDEMLRRAIEESKEMGSLGKRTREESEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.69
4 0.7
5 0.65
6 0.61
7 0.61
8 0.55
9 0.52
10 0.5
11 0.49
12 0.43
13 0.39
14 0.37
15 0.31
16 0.31
17 0.28
18 0.3
19 0.33
20 0.35
21 0.37
22 0.41
23 0.46
24 0.52
25 0.56
26 0.61
27 0.63
28 0.69
29 0.75
30 0.81
31 0.84
32 0.81
33 0.79
34 0.79
35 0.8
36 0.81
37 0.8
38 0.75
39 0.68
40 0.65
41 0.61
42 0.52
43 0.42
44 0.32
45 0.24
46 0.18
47 0.14
48 0.11
49 0.11
50 0.1
51 0.1
52 0.1
53 0.13
54 0.22
55 0.32
56 0.37
57 0.43
58 0.5
59 0.54
60 0.6
61 0.63
62 0.64
63 0.61
64 0.61
65 0.64
66 0.59
67 0.61
68 0.56
69 0.5
70 0.44
71 0.38
72 0.3
73 0.24
74 0.26
75 0.22
76 0.21
77 0.23
78 0.19
79 0.19
80 0.19
81 0.15
82 0.11
83 0.09
84 0.09
85 0.06
86 0.05
87 0.04
88 0.05
89 0.05
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.1
97 0.12
98 0.13
99 0.15
100 0.15
101 0.15
102 0.14
103 0.13
104 0.11
105 0.13
106 0.12
107 0.12
108 0.13
109 0.14
110 0.14
111 0.14
112 0.14
113 0.09
114 0.11
115 0.1
116 0.09
117 0.09
118 0.08
119 0.08
120 0.08
121 0.08
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.07
128 0.07
129 0.08
130 0.09
131 0.1
132 0.1
133 0.1
134 0.1
135 0.1
136 0.1
137 0.09
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.04
149 0.05
150 0.06
151 0.07
152 0.08
153 0.1
154 0.1
155 0.12
156 0.18
157 0.24
158 0.29
159 0.37
160 0.39
161 0.43
162 0.46
163 0.47
164 0.46
165 0.42
166 0.4
167 0.37
168 0.44
169 0.39
170 0.38
171 0.38
172 0.38
173 0.42
174 0.39
175 0.36
176 0.28
177 0.3
178 0.3
179 0.29
180 0.28
181 0.25
182 0.28
183 0.26
184 0.26
185 0.23
186 0.22
187 0.25
188 0.32
189 0.36
190 0.34
191 0.39
192 0.4
193 0.48
194 0.5
195 0.47
196 0.46
197 0.42
198 0.43
199 0.46
200 0.51
201 0.51
202 0.54
203 0.56
204 0.56
205 0.61
206 0.66
207 0.65
208 0.67
209 0.61
210 0.55
211 0.58
212 0.57
213 0.54
214 0.56
215 0.58
216 0.54
217 0.53
218 0.54
219 0.48
220 0.43
221 0.39
222 0.32
223 0.25
224 0.22
225 0.21
226 0.2
227 0.19
228 0.16
229 0.16
230 0.17
231 0.17
232 0.18
233 0.2
234 0.21
235 0.21
236 0.21
237 0.22
238 0.21
239 0.26
240 0.29
241 0.34
242 0.34
243 0.37