Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GIN0

Protein Details
Accession C1GIN0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-40WKIPWRLSAPQKARQRKRLRAVDKVVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG pbn:PADG_07116  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLMGGLLWKIPWRLSAPQKARQRKRLRAVDKVVDTVSAALERKGMTSKAVTRWFAEMPREEEMLPKDKYTIFDRKEKKYRKGIHSMFFLFPSSPNGPESANESIPPDSERPIPSLPRITPFLHSMCMYTAIHIMTGTHPADPTTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.18
5 0.21
6 0.27
7 0.34
8 0.44
9 0.48
10 0.56
11 0.66
12 0.74
13 0.79
14 0.81
15 0.83
16 0.83
17 0.86
18 0.88
19 0.85
20 0.84
21 0.82
22 0.79
23 0.71
24 0.63
25 0.53
26 0.42
27 0.35
28 0.26
29 0.19
30 0.12
31 0.1
32 0.08
33 0.09
34 0.09
35 0.1
36 0.11
37 0.11
38 0.11
39 0.14
40 0.17
41 0.23
42 0.28
43 0.28
44 0.27
45 0.3
46 0.29
47 0.28
48 0.28
49 0.23
50 0.21
51 0.22
52 0.22
53 0.19
54 0.2
55 0.2
56 0.23
57 0.21
58 0.18
59 0.17
60 0.17
61 0.19
62 0.22
63 0.28
64 0.25
65 0.33
66 0.39
67 0.46
68 0.55
69 0.6
70 0.63
71 0.65
72 0.7
73 0.69
74 0.74
75 0.71
76 0.66
77 0.64
78 0.59
79 0.5
80 0.42
81 0.36
82 0.26
83 0.21
84 0.21
85 0.18
86 0.16
87 0.15
88 0.15
89 0.15
90 0.15
91 0.19
92 0.17
93 0.16
94 0.16
95 0.17
96 0.17
97 0.17
98 0.19
99 0.15
100 0.14
101 0.18
102 0.18
103 0.21
104 0.24
105 0.26
106 0.28
107 0.33
108 0.33
109 0.33
110 0.35
111 0.33
112 0.33
113 0.34
114 0.31
115 0.28
116 0.27
117 0.23
118 0.21
119 0.23
120 0.2
121 0.17
122 0.17
123 0.15
124 0.15
125 0.13
126 0.13
127 0.11
128 0.16
129 0.15
130 0.14
131 0.15