Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CA71

Protein Details
Accession A0A1C1CA71   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-109VQQQRPRPVTEKKENNRRKRRGLARITIHHydrophilic
NLS Segment(s)
PositionSequence
91-104EKKENNRRKRRGLA
Subcellular Location(s) nucl 13, cyto 5.5, cyto_mito 5, pero 4, mito 3.5
Family & Domain DBs
Amino Acid Sequences MGGVAAHGLGTPTVANMLETSAYLFGRPTSNPFEYMVILLPNSPRIFNRPDKKFLWVNKSADAVSLSSSDRAEKLRIFQFVQQQRPRPVTEKKENNRRKRRGLARITIHPGPVTPSNPAGIRRYRPLSIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.07
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.09
13 0.11
14 0.12
15 0.15
16 0.2
17 0.22
18 0.23
19 0.24
20 0.24
21 0.22
22 0.22
23 0.19
24 0.13
25 0.11
26 0.1
27 0.1
28 0.12
29 0.12
30 0.12
31 0.12
32 0.16
33 0.21
34 0.3
35 0.39
36 0.4
37 0.45
38 0.45
39 0.5
40 0.52
41 0.52
42 0.51
43 0.48
44 0.45
45 0.41
46 0.41
47 0.36
48 0.3
49 0.25
50 0.17
51 0.12
52 0.11
53 0.09
54 0.08
55 0.09
56 0.08
57 0.09
58 0.1
59 0.11
60 0.1
61 0.15
62 0.17
63 0.19
64 0.2
65 0.23
66 0.31
67 0.36
68 0.44
69 0.46
70 0.49
71 0.52
72 0.53
73 0.53
74 0.5
75 0.52
76 0.52
77 0.57
78 0.61
79 0.66
80 0.74
81 0.81
82 0.86
83 0.88
84 0.88
85 0.86
86 0.86
87 0.87
88 0.86
89 0.85
90 0.84
91 0.8
92 0.79
93 0.77
94 0.68
95 0.59
96 0.49
97 0.4
98 0.35
99 0.32
100 0.26
101 0.22
102 0.22
103 0.24
104 0.26
105 0.29
106 0.31
107 0.34
108 0.38
109 0.43
110 0.47