Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GLJ7

Protein Details
Accession C1GLJ7    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRASNGRNKKGRGHVKPIRCSNCSHydrophilic
81-111GKIVRVRSREGRRNRAPPPRIRYNRDAKKSNBasic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
85-109RVRSREGRRNRAPPPRIRYNRDAKK
Subcellular Location(s) nucl 14.5, mito_nucl 11, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbn:PADG_08238  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFPDYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRYNRDAKKSNPTQAAKAAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.77
6 0.82
7 0.84
8 0.8
9 0.73
10 0.72
11 0.69
12 0.69
13 0.68
14 0.66
15 0.63
16 0.65
17 0.68
18 0.69
19 0.71
20 0.71
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.67
27 0.68
28 0.6
29 0.52
30 0.45
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.1
54 0.13
55 0.16
56 0.17
57 0.2
58 0.22
59 0.22
60 0.23
61 0.25
62 0.22
63 0.19
64 0.19
65 0.18
66 0.19
67 0.19
68 0.21
69 0.22
70 0.28
71 0.31
72 0.32
73 0.35
74 0.4
75 0.49
76 0.55
77 0.61
78 0.65
79 0.69
80 0.75
81 0.8
82 0.81
83 0.8
84 0.8
85 0.79
86 0.8
87 0.8
88 0.79
89 0.79
90 0.79
91 0.81
92 0.81
93 0.79
94 0.72
95 0.74
96 0.75
97 0.75
98 0.74
99 0.67
100 0.63
101 0.64