Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CB58

Protein Details
Accession A0A1C1CB58   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-37GLSQEMRREERRAKRERRKARRRERAQHSQSLQQBasic
NLS Segment(s)
PositionSequence
10-28RREERRAKRERRKARRRER
Subcellular Location(s) nucl 13.5, cyto_nucl 8.5, mito 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MARGLSQEMRREERRAKRERRKARRRERAQHSQSLQQQSSKLSKETKVKAEEIGHHLDLVAAAGKEFCHKLEAFSCDKHAQGHDLTDAAITRLAMACPNLQTVKLTSTTKLTDESVLAFLTLCPGLHTLSIVGNYPTKGNITGKLAFAELRQNKALGKHLHTLKVVDQRVDEDDAMRLSRARKNLVVWRRYVIFHAGEVVLDYKDLSESESEDESADEGEYEYGDWLTFWDIQDALPEWERWHHW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.76
4 0.8
5 0.87
6 0.91
7 0.93
8 0.94
9 0.95
10 0.95
11 0.95
12 0.95
13 0.95
14 0.94
15 0.94
16 0.9
17 0.89
18 0.81
19 0.79
20 0.75
21 0.73
22 0.65
23 0.57
24 0.51
25 0.46
26 0.49
27 0.43
28 0.39
29 0.35
30 0.4
31 0.46
32 0.5
33 0.53
34 0.52
35 0.5
36 0.51
37 0.5
38 0.49
39 0.45
40 0.44
41 0.36
42 0.31
43 0.29
44 0.24
45 0.2
46 0.15
47 0.11
48 0.06
49 0.06
50 0.06
51 0.06
52 0.08
53 0.09
54 0.09
55 0.11
56 0.11
57 0.14
58 0.18
59 0.23
60 0.24
61 0.24
62 0.28
63 0.26
64 0.27
65 0.26
66 0.23
67 0.21
68 0.18
69 0.18
70 0.15
71 0.13
72 0.13
73 0.11
74 0.1
75 0.08
76 0.07
77 0.06
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.1
86 0.1
87 0.09
88 0.1
89 0.1
90 0.11
91 0.14
92 0.14
93 0.13
94 0.15
95 0.16
96 0.16
97 0.17
98 0.15
99 0.13
100 0.12
101 0.12
102 0.1
103 0.09
104 0.08
105 0.07
106 0.06
107 0.06
108 0.06
109 0.05
110 0.04
111 0.05
112 0.05
113 0.05
114 0.06
115 0.05
116 0.06
117 0.06
118 0.06
119 0.07
120 0.07
121 0.08
122 0.08
123 0.08
124 0.08
125 0.1
126 0.1
127 0.12
128 0.15
129 0.16
130 0.16
131 0.17
132 0.16
133 0.15
134 0.14
135 0.21
136 0.19
137 0.2
138 0.2
139 0.2
140 0.21
141 0.23
142 0.29
143 0.24
144 0.26
145 0.31
146 0.33
147 0.36
148 0.36
149 0.35
150 0.34
151 0.38
152 0.36
153 0.29
154 0.27
155 0.25
156 0.27
157 0.27
158 0.22
159 0.14
160 0.14
161 0.14
162 0.14
163 0.12
164 0.12
165 0.13
166 0.18
167 0.21
168 0.24
169 0.25
170 0.3
171 0.39
172 0.46
173 0.47
174 0.45
175 0.45
176 0.43
177 0.42
178 0.38
179 0.33
180 0.25
181 0.21
182 0.21
183 0.17
184 0.15
185 0.15
186 0.14
187 0.1
188 0.09
189 0.08
190 0.06
191 0.07
192 0.07
193 0.07
194 0.07
195 0.08
196 0.11
197 0.13
198 0.13
199 0.12
200 0.12
201 0.12
202 0.11
203 0.1
204 0.07
205 0.07
206 0.06
207 0.06
208 0.06
209 0.07
210 0.06
211 0.06
212 0.06
213 0.06
214 0.09
215 0.11
216 0.11
217 0.12
218 0.12
219 0.12
220 0.16
221 0.17
222 0.18
223 0.19
224 0.19
225 0.19