Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CGJ5

Protein Details
Accession A0A1C1CGJ5   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-105SIKALLPCKRCKICKKRAKNSSQLSTGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MGANMSSSSPPDAQEEPSEKKCDCHIRVVRYFCRTCDENGVRTLLPSPFYRDNPRKFWVVDITCEGHGRSEITKDVRSIKALLPCKRCKICKKRAKNSSQLSTGTSDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.34
4 0.38
5 0.41
6 0.37
7 0.37
8 0.42
9 0.45
10 0.42
11 0.46
12 0.48
13 0.53
14 0.6
15 0.65
16 0.64
17 0.62
18 0.61
19 0.51
20 0.49
21 0.42
22 0.37
23 0.4
24 0.37
25 0.32
26 0.32
27 0.33
28 0.27
29 0.26
30 0.26
31 0.16
32 0.15
33 0.14
34 0.18
35 0.19
36 0.22
37 0.31
38 0.37
39 0.41
40 0.44
41 0.45
42 0.42
43 0.39
44 0.38
45 0.37
46 0.3
47 0.27
48 0.25
49 0.24
50 0.23
51 0.23
52 0.21
53 0.13
54 0.12
55 0.12
56 0.1
57 0.1
58 0.13
59 0.16
60 0.17
61 0.19
62 0.24
63 0.24
64 0.25
65 0.26
66 0.26
67 0.31
68 0.37
69 0.43
70 0.47
71 0.52
72 0.59
73 0.64
74 0.69
75 0.72
76 0.75
77 0.78
78 0.8
79 0.85
80 0.87
81 0.9
82 0.91
83 0.9
84 0.89
85 0.87
86 0.82
87 0.72
88 0.64