Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1D265

Protein Details
Accession A0A1C1D265   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-38LCLTSHAQGKRKKSSRKPQGPRKREPLASHydrophilic
NLS Segment(s)
PositionSequence
18-33GKRKKSSRKPQGPRKR
Subcellular Location(s) cyto_mito 11.166, mito 10.5, cyto 10.5, cyto_nucl 9.333, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MPLETFPHGLCLTSHAQGKRKKSSRKPQGPRKREPLASTFTCLFCNHEKAIQVKLDKKAGVGNLHCKVCNQKYQTGINYLSAAVDVYSDWVDACEEVAKQAAEEEAEDAKFSSYATGTGAARAGVPAGGGGGGGADDEEDDAEYGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.37
4 0.42
5 0.51
6 0.57
7 0.63
8 0.69
9 0.74
10 0.81
11 0.85
12 0.89
13 0.92
14 0.92
15 0.94
16 0.93
17 0.92
18 0.89
19 0.86
20 0.79
21 0.73
22 0.67
23 0.62
24 0.55
25 0.49
26 0.43
27 0.36
28 0.32
29 0.28
30 0.27
31 0.23
32 0.25
33 0.22
34 0.22
35 0.24
36 0.24
37 0.27
38 0.27
39 0.28
40 0.29
41 0.32
42 0.33
43 0.3
44 0.29
45 0.27
46 0.26
47 0.26
48 0.23
49 0.27
50 0.28
51 0.29
52 0.29
53 0.27
54 0.3
55 0.29
56 0.34
57 0.3
58 0.29
59 0.32
60 0.36
61 0.36
62 0.34
63 0.32
64 0.26
65 0.23
66 0.19
67 0.14
68 0.11
69 0.09
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.07
85 0.06
86 0.06
87 0.07
88 0.07
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.07
100 0.06
101 0.07
102 0.07
103 0.1
104 0.1
105 0.11
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.05