Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CM92

Protein Details
Accession A0A1C1CM92    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-64KHTGSWLERNRRKQRRTRIFGWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAVQDPAFWKRFSVAVHQQDEEKANMSDGGSLSTVSSRPQLKHTGSWLERNRRKQRRTRIFGWLIAFGFIIVIAAVVLVLLWFSKVGPFKDRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.39
4 0.42
5 0.42
6 0.42
7 0.41
8 0.42
9 0.34
10 0.26
11 0.18
12 0.15
13 0.15
14 0.14
15 0.13
16 0.1
17 0.11
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.07
24 0.12
25 0.13
26 0.14
27 0.18
28 0.23
29 0.24
30 0.26
31 0.28
32 0.32
33 0.31
34 0.39
35 0.42
36 0.47
37 0.51
38 0.6
39 0.68
40 0.69
41 0.76
42 0.76
43 0.81
44 0.82
45 0.83
46 0.78
47 0.77
48 0.71
49 0.67
50 0.6
51 0.51
52 0.4
53 0.33
54 0.28
55 0.17
56 0.13
57 0.09
58 0.06
59 0.03
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.03
71 0.03
72 0.08
73 0.13
74 0.16