Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1D1C8

Protein Details
Accession A0A1C1D1C8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-45ARRKDAKGARLKKSNKSKDIKLKLRGKRFLYBasic
NLS Segment(s)
PositionSequence
16-42RRKDAKGARLKKSNKSKDIKLKLRGKR
120-129GKKNKKPKKN
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, mito 9, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVTDIKQFLEIARRKDAKGARLKKSNKSKDIKLKLRGKRFLYTLILKDSDKADKIKQSLPPRAVGRAKEGGRKAYPAGCAVKEQVFTFVEAGGSRKLCKRGTRPDKGGHAMDFQEIGKKNKKPKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.39
3 0.41
4 0.39
5 0.47
6 0.5
7 0.49
8 0.55
9 0.6
10 0.59
11 0.66
12 0.71
13 0.74
14 0.8
15 0.81
16 0.79
17 0.77
18 0.78
19 0.79
20 0.84
21 0.82
22 0.81
23 0.81
24 0.8
25 0.83
26 0.81
27 0.74
28 0.68
29 0.61
30 0.56
31 0.51
32 0.46
33 0.39
34 0.35
35 0.32
36 0.28
37 0.27
38 0.24
39 0.21
40 0.19
41 0.19
42 0.19
43 0.21
44 0.23
45 0.26
46 0.31
47 0.36
48 0.4
49 0.39
50 0.42
51 0.39
52 0.42
53 0.41
54 0.35
55 0.32
56 0.33
57 0.33
58 0.34
59 0.34
60 0.33
61 0.31
62 0.31
63 0.28
64 0.24
65 0.24
66 0.21
67 0.22
68 0.18
69 0.19
70 0.19
71 0.2
72 0.18
73 0.17
74 0.17
75 0.15
76 0.15
77 0.14
78 0.12
79 0.11
80 0.1
81 0.12
82 0.11
83 0.12
84 0.13
85 0.18
86 0.23
87 0.27
88 0.35
89 0.43
90 0.51
91 0.61
92 0.69
93 0.71
94 0.73
95 0.76
96 0.74
97 0.68
98 0.59
99 0.52
100 0.43
101 0.37
102 0.31
103 0.23
104 0.25
105 0.25
106 0.29
107 0.34
108 0.4
109 0.5