Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C1CN60

Protein Details
Accession A0A1C1CN60    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-34GHAIHERKEKKREKARLTEEQFBasic
NLS Segment(s)
PositionSequence
19-26RKEKKREK
Subcellular Location(s) nucl 13, mito_nucl 12.499, mito 10.5, cyto_nucl 9.833
Family & Domain DBs
Amino Acid Sequences MASIIVGSALLIGHAIHERKEKKREKARLTEEQFSDAHGKPALVSSRRLRKQQQVEMPELPSYESVVSERPGFSTVRDGDEKPRRRSEDNSKIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.12
4 0.21
5 0.28
6 0.35
7 0.46
8 0.53
9 0.6
10 0.7
11 0.77
12 0.78
13 0.82
14 0.83
15 0.83
16 0.8
17 0.76
18 0.67
19 0.59
20 0.5
21 0.41
22 0.38
23 0.28
24 0.24
25 0.17
26 0.16
27 0.13
28 0.16
29 0.18
30 0.15
31 0.18
32 0.23
33 0.32
34 0.37
35 0.41
36 0.43
37 0.48
38 0.55
39 0.59
40 0.6
41 0.54
42 0.55
43 0.52
44 0.49
45 0.41
46 0.32
47 0.25
48 0.17
49 0.14
50 0.1
51 0.08
52 0.08
53 0.09
54 0.1
55 0.11
56 0.11
57 0.11
58 0.12
59 0.12
60 0.12
61 0.18
62 0.19
63 0.22
64 0.26
65 0.26
66 0.35
67 0.45
68 0.53
69 0.53
70 0.61
71 0.62
72 0.64
73 0.71
74 0.72