Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1G7E9

Protein Details
Accession C1G7E9   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSTPEPANKKRGRPKKVVVVVAPHydrophilic
NLS Segment(s)
PositionSequence
10-17KKRGRPKK
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
KEGG pbn:PADG_03104  -  
Amino Acid Sequences MSSTPEPANKKRGRPKKVVVVVAPNKSSAGTTAAASTTANAAIQRSSPTYTNNPNPATTTTTITPRKASTKAHPAPVSEINQTTPAAIREKSSVTKGCPTPLKSTKSPSTTSTSNPPSQLSIKFQTPSTQSNPHSATAAIREKQKWDRKQQVGAGAGPSTVQANGDISSRAKSARIENTIVGQGNQGGLRPQPETIPVKPFVDGAAAQGSNILNSLAASNNSKSAAAEDKFNRIAGSTGSTTNMAPPVRKFSASPSQQSSSPPPIKPPAKRASPLSAQRLSSQRLEPAQAQAESAKLRDIRQTKQYKTLARRWTSAMVALPILIYTSYELYERVFANKPPRSLPGTNHFPPVNENSRSPSPSPSPITPSSASTTET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.84
4 0.86
5 0.83
6 0.77
7 0.78
8 0.76
9 0.73
10 0.65
11 0.54
12 0.46
13 0.38
14 0.33
15 0.24
16 0.19
17 0.14
18 0.13
19 0.14
20 0.14
21 0.14
22 0.14
23 0.13
24 0.1
25 0.1
26 0.1
27 0.09
28 0.09
29 0.1
30 0.12
31 0.14
32 0.15
33 0.18
34 0.19
35 0.23
36 0.3
37 0.37
38 0.44
39 0.49
40 0.49
41 0.47
42 0.48
43 0.46
44 0.44
45 0.37
46 0.34
47 0.28
48 0.35
49 0.39
50 0.38
51 0.39
52 0.36
53 0.4
54 0.4
55 0.44
56 0.43
57 0.5
58 0.53
59 0.58
60 0.57
61 0.53
62 0.53
63 0.54
64 0.49
65 0.41
66 0.36
67 0.29
68 0.29
69 0.27
70 0.22
71 0.18
72 0.17
73 0.17
74 0.16
75 0.17
76 0.17
77 0.21
78 0.23
79 0.26
80 0.28
81 0.28
82 0.35
83 0.35
84 0.38
85 0.42
86 0.42
87 0.46
88 0.51
89 0.54
90 0.5
91 0.56
92 0.57
93 0.55
94 0.54
95 0.48
96 0.46
97 0.42
98 0.41
99 0.43
100 0.41
101 0.39
102 0.38
103 0.35
104 0.33
105 0.34
106 0.33
107 0.3
108 0.28
109 0.28
110 0.28
111 0.28
112 0.29
113 0.29
114 0.31
115 0.31
116 0.35
117 0.33
118 0.38
119 0.4
120 0.36
121 0.33
122 0.29
123 0.25
124 0.24
125 0.28
126 0.24
127 0.27
128 0.28
129 0.32
130 0.41
131 0.5
132 0.51
133 0.56
134 0.63
135 0.63
136 0.68
137 0.66
138 0.63
139 0.56
140 0.48
141 0.39
142 0.29
143 0.24
144 0.18
145 0.15
146 0.09
147 0.06
148 0.05
149 0.04
150 0.05
151 0.06
152 0.06
153 0.07
154 0.07
155 0.08
156 0.09
157 0.09
158 0.1
159 0.11
160 0.15
161 0.2
162 0.23
163 0.24
164 0.23
165 0.24
166 0.25
167 0.24
168 0.19
169 0.13
170 0.1
171 0.09
172 0.09
173 0.07
174 0.06
175 0.06
176 0.07
177 0.08
178 0.08
179 0.08
180 0.12
181 0.16
182 0.17
183 0.21
184 0.21
185 0.21
186 0.21
187 0.21
188 0.16
189 0.14
190 0.12
191 0.09
192 0.1
193 0.09
194 0.09
195 0.1
196 0.1
197 0.08
198 0.08
199 0.07
200 0.04
201 0.04
202 0.05
203 0.05
204 0.06
205 0.08
206 0.08
207 0.09
208 0.1
209 0.1
210 0.09
211 0.1
212 0.15
213 0.14
214 0.2
215 0.2
216 0.24
217 0.25
218 0.25
219 0.23
220 0.17
221 0.18
222 0.12
223 0.14
224 0.11
225 0.11
226 0.12
227 0.13
228 0.13
229 0.13
230 0.16
231 0.14
232 0.14
233 0.15
234 0.21
235 0.22
236 0.23
237 0.22
238 0.25
239 0.34
240 0.36
241 0.39
242 0.38
243 0.38
244 0.39
245 0.42
246 0.41
247 0.41
248 0.43
249 0.39
250 0.38
251 0.45
252 0.51
253 0.53
254 0.57
255 0.55
256 0.55
257 0.58
258 0.58
259 0.56
260 0.57
261 0.59
262 0.58
263 0.54
264 0.49
265 0.5
266 0.5
267 0.47
268 0.42
269 0.37
270 0.34
271 0.31
272 0.33
273 0.3
274 0.29
275 0.3
276 0.26
277 0.25
278 0.21
279 0.22
280 0.2
281 0.18
282 0.18
283 0.16
284 0.17
285 0.25
286 0.29
287 0.32
288 0.41
289 0.5
290 0.49
291 0.57
292 0.62
293 0.63
294 0.67
295 0.71
296 0.71
297 0.66
298 0.65
299 0.6
300 0.57
301 0.49
302 0.44
303 0.37
304 0.28
305 0.24
306 0.21
307 0.16
308 0.12
309 0.11
310 0.08
311 0.06
312 0.06
313 0.07
314 0.08
315 0.08
316 0.09
317 0.1
318 0.13
319 0.14
320 0.17
321 0.19
322 0.23
323 0.33
324 0.38
325 0.4
326 0.4
327 0.45
328 0.48
329 0.49
330 0.51
331 0.5
332 0.54
333 0.53
334 0.56
335 0.52
336 0.45
337 0.46
338 0.47
339 0.46
340 0.41
341 0.4
342 0.41
343 0.47
344 0.51
345 0.48
346 0.47
347 0.44
348 0.48
349 0.52
350 0.49
351 0.5
352 0.49
353 0.53
354 0.47
355 0.45
356 0.42