Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1FZ83

Protein Details
Accession C1FZ83    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-54TELMAPKPKQHNPQLPKKDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 9.5, cyto 7, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036265  HIT-like_sf  
IPR032566  Znf-C2HE  
KEGG pbn:PADG_01109  -  
Pfam View protein in Pfam  
PF11969  DcpS_C  
PF16278  zf-C2HE  
Amino Acid Sequences MSRNTSRGSSPGGAGPPAESLLDLKEQPQGRNAFTELMAPKPKQHNPQLPKKDPISTSHKVSSLCKSRDGLGEYIENPSSFPPTRVLYYNDDFVAIHDLYPKSSLHLLLLPCDPTKTHLHPFDAFEDLDFLRKVQKETKKLKQFAAAELRRMYSTVSAQERARQEAMDADPPPDELPPGRDWEKEIMCGIHAHPSMNHLHIHVLAVDRFSSCLKHRRHYNSFSTPFFIDVQDFPLAKDDVRRHPGKEGYLRWDIKCWRCGRMFGNKFKQLKDHLEEEFLDWRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.19
4 0.17
5 0.15
6 0.11
7 0.1
8 0.11
9 0.14
10 0.14
11 0.14
12 0.19
13 0.23
14 0.24
15 0.3
16 0.32
17 0.3
18 0.33
19 0.34
20 0.29
21 0.25
22 0.31
23 0.25
24 0.28
25 0.33
26 0.3
27 0.36
28 0.42
29 0.49
30 0.51
31 0.6
32 0.64
33 0.67
34 0.77
35 0.81
36 0.79
37 0.79
38 0.73
39 0.7
40 0.61
41 0.59
42 0.57
43 0.5
44 0.5
45 0.47
46 0.47
47 0.42
48 0.43
49 0.46
50 0.47
51 0.45
52 0.43
53 0.4
54 0.39
55 0.42
56 0.43
57 0.34
58 0.27
59 0.27
60 0.24
61 0.26
62 0.23
63 0.18
64 0.15
65 0.14
66 0.17
67 0.15
68 0.16
69 0.16
70 0.18
71 0.2
72 0.22
73 0.26
74 0.27
75 0.28
76 0.29
77 0.26
78 0.24
79 0.21
80 0.19
81 0.2
82 0.14
83 0.12
84 0.14
85 0.14
86 0.14
87 0.15
88 0.15
89 0.12
90 0.13
91 0.13
92 0.1
93 0.14
94 0.14
95 0.14
96 0.15
97 0.15
98 0.14
99 0.14
100 0.13
101 0.13
102 0.18
103 0.2
104 0.25
105 0.27
106 0.31
107 0.32
108 0.34
109 0.32
110 0.29
111 0.24
112 0.18
113 0.17
114 0.13
115 0.13
116 0.11
117 0.09
118 0.12
119 0.13
120 0.15
121 0.21
122 0.28
123 0.36
124 0.44
125 0.54
126 0.59
127 0.61
128 0.61
129 0.6
130 0.54
131 0.5
132 0.53
133 0.44
134 0.37
135 0.35
136 0.34
137 0.27
138 0.26
139 0.2
140 0.11
141 0.12
142 0.14
143 0.15
144 0.17
145 0.18
146 0.23
147 0.24
148 0.25
149 0.24
150 0.19
151 0.17
152 0.18
153 0.19
154 0.18
155 0.17
156 0.15
157 0.15
158 0.15
159 0.16
160 0.12
161 0.11
162 0.07
163 0.1
164 0.1
165 0.15
166 0.16
167 0.17
168 0.19
169 0.24
170 0.24
171 0.22
172 0.22
173 0.17
174 0.16
175 0.17
176 0.15
177 0.17
178 0.16
179 0.15
180 0.15
181 0.17
182 0.19
183 0.19
184 0.19
185 0.13
186 0.14
187 0.13
188 0.14
189 0.12
190 0.12
191 0.1
192 0.11
193 0.1
194 0.09
195 0.1
196 0.1
197 0.13
198 0.15
199 0.23
200 0.28
201 0.36
202 0.45
203 0.54
204 0.61
205 0.66
206 0.7
207 0.72
208 0.73
209 0.66
210 0.61
211 0.51
212 0.45
213 0.38
214 0.3
215 0.22
216 0.17
217 0.19
218 0.19
219 0.19
220 0.17
221 0.2
222 0.19
223 0.18
224 0.24
225 0.27
226 0.32
227 0.4
228 0.43
229 0.41
230 0.48
231 0.52
232 0.53
233 0.56
234 0.52
235 0.51
236 0.57
237 0.59
238 0.53
239 0.56
240 0.56
241 0.54
242 0.57
243 0.53
244 0.51
245 0.51
246 0.55
247 0.54
248 0.57
249 0.59
250 0.62
251 0.69
252 0.71
253 0.72
254 0.69
255 0.69
256 0.65
257 0.65
258 0.6
259 0.55
260 0.48
261 0.48
262 0.46
263 0.42
264 0.42