Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C1CBU3

Protein Details
Accession A0A1C1CBU3    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
197-231GKNVRMEGRRERKERIKRQERRQRGNERRMRKGGGBasic
NLS Segment(s)
PositionSequence
112-136KPLPKPKAPTKWELFARKKGIGKYG
199-231NVRMEGRRERKERIKRQERRQRGNERRMRKGGG
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MAETSVSVQIPVSTLSTNTSSKPERLPTTVEKPSPYTYDLGYLNAIDPNPLPTTSSLLSQPIAQRNETLKAIARDGAQCLLNTLLTTCPINSTPDGLIMTLPAPQNYLPRWKPLPKPKAPTKWELFARKKGIGKYGGSLKGGAAQEERRKNLVYDEESGEWVKKWGYKGANKKDESQWLVELDDQKIRTEKEGADAGKNVRMEGRRERKERIKRQERRQRGNERRMRKGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.17
4 0.18
5 0.19
6 0.24
7 0.26
8 0.29
9 0.34
10 0.39
11 0.39
12 0.41
13 0.45
14 0.46
15 0.51
16 0.56
17 0.53
18 0.48
19 0.47
20 0.48
21 0.45
22 0.39
23 0.32
24 0.25
25 0.27
26 0.25
27 0.22
28 0.19
29 0.16
30 0.15
31 0.15
32 0.15
33 0.11
34 0.1
35 0.12
36 0.13
37 0.12
38 0.13
39 0.12
40 0.16
41 0.16
42 0.17
43 0.16
44 0.16
45 0.16
46 0.18
47 0.22
48 0.25
49 0.26
50 0.25
51 0.27
52 0.28
53 0.31
54 0.29
55 0.25
56 0.22
57 0.22
58 0.22
59 0.21
60 0.2
61 0.18
62 0.18
63 0.19
64 0.15
65 0.14
66 0.13
67 0.12
68 0.1
69 0.09
70 0.09
71 0.07
72 0.07
73 0.08
74 0.07
75 0.08
76 0.09
77 0.11
78 0.1
79 0.12
80 0.11
81 0.12
82 0.12
83 0.11
84 0.1
85 0.08
86 0.08
87 0.09
88 0.09
89 0.08
90 0.08
91 0.09
92 0.11
93 0.12
94 0.2
95 0.18
96 0.23
97 0.27
98 0.32
99 0.4
100 0.48
101 0.56
102 0.55
103 0.62
104 0.67
105 0.72
106 0.7
107 0.69
108 0.62
109 0.59
110 0.59
111 0.6
112 0.56
113 0.53
114 0.54
115 0.51
116 0.51
117 0.46
118 0.44
119 0.38
120 0.34
121 0.31
122 0.33
123 0.31
124 0.28
125 0.26
126 0.21
127 0.23
128 0.22
129 0.2
130 0.15
131 0.18
132 0.25
133 0.3
134 0.32
135 0.28
136 0.29
137 0.29
138 0.3
139 0.31
140 0.27
141 0.26
142 0.27
143 0.26
144 0.26
145 0.26
146 0.23
147 0.17
148 0.15
149 0.13
150 0.13
151 0.14
152 0.19
153 0.26
154 0.33
155 0.44
156 0.54
157 0.62
158 0.61
159 0.64
160 0.63
161 0.64
162 0.58
163 0.51
164 0.42
165 0.34
166 0.33
167 0.31
168 0.28
169 0.22
170 0.23
171 0.21
172 0.21
173 0.23
174 0.23
175 0.23
176 0.24
177 0.22
178 0.23
179 0.28
180 0.28
181 0.28
182 0.3
183 0.29
184 0.3
185 0.3
186 0.26
187 0.25
188 0.27
189 0.29
190 0.37
191 0.46
192 0.51
193 0.56
194 0.65
195 0.7
196 0.78
197 0.83
198 0.83
199 0.84
200 0.84
201 0.91
202 0.93
203 0.94
204 0.93
205 0.93
206 0.93
207 0.93
208 0.94
209 0.92
210 0.9
211 0.89