Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CKZ0

Protein Details
Accession A0A1C1CKZ0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
61-80KSKGALKKPKAKRWDHRLSABasic
NLS Segment(s)
PositionSequence
62-76SKGALKKPKAKRWDH
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR015421  PyrdxlP-dep_Trfase_major  
Gene Ontology GO:0003824  F:catalytic activity  
Amino Acid Sequences MAPLAEPKALTDTSSIVLNDPVLTHGETHPVFTLDYVLPHRQKSTPPSRGVAAFSEADMFKSKGALKKPKAKRWDHRLSAESRARTASSLKGAMRYFKPDTIILCGGLPSRSVPTPTVALTSRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.13
5 0.13
6 0.12
7 0.1
8 0.1
9 0.1
10 0.1
11 0.11
12 0.1
13 0.16
14 0.16
15 0.17
16 0.17
17 0.16
18 0.15
19 0.14
20 0.16
21 0.1
22 0.13
23 0.15
24 0.2
25 0.22
26 0.23
27 0.25
28 0.24
29 0.28
30 0.34
31 0.41
32 0.42
33 0.43
34 0.44
35 0.43
36 0.43
37 0.4
38 0.33
39 0.25
40 0.17
41 0.14
42 0.14
43 0.12
44 0.12
45 0.12
46 0.11
47 0.08
48 0.1
49 0.12
50 0.14
51 0.21
52 0.3
53 0.34
54 0.44
55 0.54
56 0.6
57 0.67
58 0.72
59 0.75
60 0.76
61 0.8
62 0.76
63 0.73
64 0.69
65 0.63
66 0.63
67 0.59
68 0.5
69 0.41
70 0.36
71 0.31
72 0.28
73 0.26
74 0.2
75 0.18
76 0.21
77 0.21
78 0.24
79 0.25
80 0.29
81 0.29
82 0.32
83 0.32
84 0.3
85 0.32
86 0.28
87 0.29
88 0.3
89 0.3
90 0.24
91 0.21
92 0.2
93 0.18
94 0.17
95 0.16
96 0.11
97 0.14
98 0.15
99 0.17
100 0.17
101 0.19
102 0.21
103 0.22
104 0.24
105 0.22