Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C1CKI3

Protein Details
Accession A0A1C1CKI3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-93GSPSGLKEKLPKRKPKESRWRRLFGRKRRRBasic
NLS Segment(s)
PositionSequence
70-93KEKLPKRKPKESRWRRLFGRKRRR
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MSWTPSFYQKRKATQRDTGTTQPGAAGLPPRLRRGEYNTFTKPGRLQKEIRWPEPDSTAQSDDGSPSGLKEKLPKRKPKESRWRRLFGRKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.76
4 0.75
5 0.7
6 0.64
7 0.55
8 0.47
9 0.37
10 0.29
11 0.22
12 0.17
13 0.14
14 0.13
15 0.19
16 0.21
17 0.24
18 0.25
19 0.27
20 0.28
21 0.33
22 0.4
23 0.38
24 0.43
25 0.42
26 0.44
27 0.42
28 0.41
29 0.38
30 0.36
31 0.36
32 0.34
33 0.34
34 0.37
35 0.48
36 0.51
37 0.5
38 0.47
39 0.44
40 0.41
41 0.42
42 0.38
43 0.3
44 0.28
45 0.27
46 0.23
47 0.21
48 0.2
49 0.17
50 0.15
51 0.13
52 0.09
53 0.09
54 0.11
55 0.12
56 0.13
57 0.21
58 0.3
59 0.39
60 0.49
61 0.59
62 0.64
63 0.74
64 0.83
65 0.86
66 0.88
67 0.89
68 0.91
69 0.9
70 0.9
71 0.88
72 0.9
73 0.89