Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CLI1

Protein Details
Accession A0A1C1CLI1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-52QHQQHQQQQQQQRRRRRRRPQAKYAEIPFHydrophilic
NLS Segment(s)
PositionSequence
36-43RRRRRRRP
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MFVCEHPPTSARTQQHQQHQQHQQHQQHQQQQQQQRRRRRRRPQAKYAEIPFEGIDFMWDVVGAHFPAEAMNDKDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.67
4 0.66
5 0.68
6 0.75
7 0.75
8 0.75
9 0.78
10 0.75
11 0.74
12 0.76
13 0.74
14 0.73
15 0.71
16 0.69
17 0.67
18 0.68
19 0.69
20 0.7
21 0.71
22 0.73
23 0.78
24 0.83
25 0.86
26 0.88
27 0.9
28 0.92
29 0.93
30 0.93
31 0.92
32 0.89
33 0.85
34 0.77
35 0.71
36 0.6
37 0.51
38 0.4
39 0.29
40 0.22
41 0.14
42 0.11
43 0.07
44 0.07
45 0.05
46 0.05
47 0.05
48 0.05
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.07
55 0.09
56 0.12