Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1D2F8

Protein Details
Accession A0A1C1D2F8   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-45QTPKVEPQEKKKTPKGRAKKRITYTRRFVHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRITYTRRFVNVTMTGGKRKCTEQKRHDADFERAVARGGGGGGSGSGSMSLASYGFEVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.49
5 0.51
6 0.61
7 0.63
8 0.68
9 0.68
10 0.7
11 0.74
12 0.75
13 0.78
14 0.77
15 0.79
16 0.78
17 0.82
18 0.83
19 0.83
20 0.86
21 0.88
22 0.88
23 0.87
24 0.88
25 0.86
26 0.83
27 0.78
28 0.76
29 0.7
30 0.63
31 0.54
32 0.48
33 0.42
34 0.35
35 0.32
36 0.25
37 0.26
38 0.25
39 0.27
40 0.23
41 0.25
42 0.32
43 0.38
44 0.47
45 0.51
46 0.61
47 0.66
48 0.68
49 0.7
50 0.66
51 0.61
52 0.54
53 0.47
54 0.37
55 0.3
56 0.27
57 0.21
58 0.16
59 0.12
60 0.08
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06