Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C1CF21

Protein Details
Accession A0A1C1CF21    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGPPIRPLPRRKEWPGRECILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003673  CoA-Trfase_fam_III  
IPR044855  CoA-Trfase_III_dom3_sf  
IPR023606  CoA-Trfase_III_dom_1_sf  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF02515  CoA_transf_3  
Amino Acid Sequences MGPPIRPLPRRKEWPGRECILSLGKRPKDQSFSGGIGQSSGHVNKLKVNRNKKSLGVSFQHPEGAEIIRELAKTADVFVENFLPGTLKKYGLDFPTLQQTNPRLIYASITGYGQYGPYSDRAGYDVMVEAEMGLMHITGTRDGPPVKVGCAVTDLTTGMYACNSIMAALLERHNSNRGQHLDVCLSDCQVATLSNMAESVLISKKRDSGRWGTAHPSVVPYRAFRTSDGDVLFGGGNDRLFGILCAGLGKQEWASDERFATNAARVANRGVLEPAIEEITKQKTTQEWLDIFEGTGLPYAKVNDLMDTLNHKHGEYPDTAFFFEDSGSPSITVRAREMVVSIDHPSCGVMDLVNTPVKYSRSKPSIRSPPPLLGQHTDEILSARLGFDAQRIHELRARGAVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.8
4 0.73
5 0.64
6 0.59
7 0.57
8 0.49
9 0.48
10 0.5
11 0.51
12 0.53
13 0.57
14 0.59
15 0.57
16 0.56
17 0.53
18 0.49
19 0.47
20 0.45
21 0.42
22 0.35
23 0.29
24 0.26
25 0.22
26 0.21
27 0.18
28 0.19
29 0.2
30 0.21
31 0.27
32 0.36
33 0.45
34 0.5
35 0.6
36 0.65
37 0.69
38 0.73
39 0.7
40 0.7
41 0.66
42 0.64
43 0.58
44 0.55
45 0.51
46 0.47
47 0.46
48 0.37
49 0.32
50 0.25
51 0.22
52 0.16
53 0.13
54 0.14
55 0.13
56 0.13
57 0.12
58 0.11
59 0.11
60 0.1
61 0.11
62 0.11
63 0.11
64 0.11
65 0.12
66 0.13
67 0.12
68 0.12
69 0.11
70 0.1
71 0.09
72 0.13
73 0.14
74 0.13
75 0.14
76 0.16
77 0.21
78 0.22
79 0.26
80 0.23
81 0.23
82 0.32
83 0.32
84 0.3
85 0.31
86 0.31
87 0.33
88 0.32
89 0.31
90 0.22
91 0.21
92 0.23
93 0.19
94 0.19
95 0.13
96 0.12
97 0.12
98 0.11
99 0.11
100 0.1
101 0.08
102 0.07
103 0.07
104 0.08
105 0.1
106 0.1
107 0.1
108 0.11
109 0.12
110 0.11
111 0.1
112 0.1
113 0.08
114 0.08
115 0.07
116 0.06
117 0.05
118 0.05
119 0.04
120 0.03
121 0.03
122 0.03
123 0.04
124 0.05
125 0.05
126 0.07
127 0.08
128 0.1
129 0.11
130 0.12
131 0.14
132 0.14
133 0.14
134 0.17
135 0.16
136 0.14
137 0.15
138 0.15
139 0.12
140 0.12
141 0.12
142 0.08
143 0.08
144 0.08
145 0.06
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.03
152 0.04
153 0.04
154 0.05
155 0.06
156 0.07
157 0.08
158 0.09
159 0.1
160 0.13
161 0.14
162 0.14
163 0.2
164 0.21
165 0.23
166 0.24
167 0.25
168 0.24
169 0.23
170 0.23
171 0.17
172 0.15
173 0.12
174 0.11
175 0.08
176 0.07
177 0.07
178 0.05
179 0.06
180 0.06
181 0.05
182 0.06
183 0.05
184 0.05
185 0.04
186 0.06
187 0.09
188 0.1
189 0.11
190 0.11
191 0.17
192 0.19
193 0.21
194 0.23
195 0.27
196 0.33
197 0.35
198 0.36
199 0.34
200 0.34
201 0.33
202 0.29
203 0.26
204 0.19
205 0.18
206 0.18
207 0.16
208 0.16
209 0.19
210 0.19
211 0.17
212 0.21
213 0.21
214 0.23
215 0.22
216 0.19
217 0.16
218 0.16
219 0.15
220 0.1
221 0.09
222 0.06
223 0.06
224 0.05
225 0.05
226 0.04
227 0.05
228 0.05
229 0.05
230 0.04
231 0.04
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.05
238 0.06
239 0.07
240 0.09
241 0.1
242 0.12
243 0.12
244 0.12
245 0.12
246 0.13
247 0.13
248 0.12
249 0.13
250 0.13
251 0.13
252 0.13
253 0.14
254 0.16
255 0.15
256 0.14
257 0.12
258 0.11
259 0.1
260 0.1
261 0.09
262 0.08
263 0.07
264 0.07
265 0.1
266 0.14
267 0.15
268 0.15
269 0.16
270 0.17
271 0.21
272 0.25
273 0.28
274 0.24
275 0.26
276 0.28
277 0.26
278 0.24
279 0.2
280 0.17
281 0.1
282 0.12
283 0.1
284 0.08
285 0.09
286 0.1
287 0.11
288 0.13
289 0.13
290 0.11
291 0.12
292 0.12
293 0.13
294 0.18
295 0.2
296 0.23
297 0.23
298 0.22
299 0.24
300 0.26
301 0.28
302 0.25
303 0.26
304 0.25
305 0.26
306 0.26
307 0.24
308 0.21
309 0.18
310 0.16
311 0.12
312 0.12
313 0.12
314 0.12
315 0.12
316 0.12
317 0.16
318 0.18
319 0.19
320 0.17
321 0.18
322 0.18
323 0.18
324 0.19
325 0.16
326 0.16
327 0.16
328 0.18
329 0.16
330 0.15
331 0.15
332 0.14
333 0.13
334 0.12
335 0.1
336 0.07
337 0.07
338 0.09
339 0.13
340 0.16
341 0.16
342 0.16
343 0.19
344 0.22
345 0.26
346 0.29
347 0.35
348 0.41
349 0.48
350 0.53
351 0.6
352 0.69
353 0.71
354 0.75
355 0.71
356 0.69
357 0.69
358 0.68
359 0.62
360 0.56
361 0.52
362 0.46
363 0.42
364 0.35
365 0.29
366 0.24
367 0.2
368 0.16
369 0.12
370 0.11
371 0.1
372 0.1
373 0.1
374 0.12
375 0.16
376 0.17
377 0.25
378 0.27
379 0.31
380 0.34
381 0.36
382 0.35