Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1C9S0

Protein Details
Accession A0A1C1C9S0    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AGPSKLRASKRPFREQKKQVKLQFSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MAGPSKLRASKRPFREQKKQVKLQFSPLPSSSSPAKDRYSAAVQDRLAGISYEGAKDPTRAARGLSPESASLPSPEPSSQIPGETQGMVEYMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.86
4 0.88
5 0.89
6 0.89
7 0.85
8 0.84
9 0.76
10 0.74
11 0.7
12 0.61
13 0.55
14 0.47
15 0.44
16 0.35
17 0.36
18 0.3
19 0.28
20 0.29
21 0.28
22 0.29
23 0.26
24 0.27
25 0.28
26 0.28
27 0.27
28 0.26
29 0.27
30 0.25
31 0.24
32 0.23
33 0.19
34 0.16
35 0.12
36 0.1
37 0.06
38 0.07
39 0.07
40 0.07
41 0.08
42 0.08
43 0.09
44 0.1
45 0.13
46 0.14
47 0.14
48 0.15
49 0.17
50 0.22
51 0.24
52 0.24
53 0.21
54 0.2
55 0.21
56 0.21
57 0.18
58 0.16
59 0.15
60 0.15
61 0.16
62 0.16
63 0.17
64 0.17
65 0.22
66 0.2
67 0.2
68 0.19
69 0.2
70 0.22
71 0.2
72 0.18
73 0.14