Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1CJN5

Protein Details
Accession A0A1C1CJN5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
73-98TGIAASPPKKRKPRAKKAAGEESNKKHydrophilic
NLS Segment(s)
PositionSequence
79-103PPKKRKPRAKKAAGEESNKKPKVKK
Subcellular Location(s) cyto 16, nucl 6.5, mito_nucl 6, mito 4.5
Family & Domain DBs
Amino Acid Sequences MANSSTDDKIAYILTVLKHTTLPKPDYTAVAVESGINTAQNAQRRLKAIVKAAGFDLVNDQIVGPDCSTGDGTGIAASPPKKRKPRAKKAAGEESNKKPKVKKEEDVEAEMNQGGEESVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.14
5 0.16
6 0.19
7 0.23
8 0.27
9 0.3
10 0.29
11 0.33
12 0.34
13 0.33
14 0.32
15 0.27
16 0.21
17 0.19
18 0.17
19 0.12
20 0.11
21 0.09
22 0.08
23 0.06
24 0.05
25 0.07
26 0.1
27 0.15
28 0.19
29 0.2
30 0.23
31 0.26
32 0.29
33 0.32
34 0.32
35 0.31
36 0.32
37 0.31
38 0.28
39 0.26
40 0.24
41 0.19
42 0.16
43 0.13
44 0.08
45 0.08
46 0.07
47 0.07
48 0.05
49 0.06
50 0.07
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.07
64 0.09
65 0.15
66 0.22
67 0.31
68 0.4
69 0.49
70 0.6
71 0.69
72 0.79
73 0.83
74 0.87
75 0.87
76 0.87
77 0.89
78 0.85
79 0.81
80 0.77
81 0.76
82 0.76
83 0.72
84 0.66
85 0.61
86 0.63
87 0.66
88 0.67
89 0.66
90 0.63
91 0.69
92 0.71
93 0.72
94 0.65
95 0.55
96 0.48
97 0.39
98 0.31
99 0.21
100 0.15