Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C1C813

Protein Details
Accession A0A1C1C813   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-101AAPTKRDCLRPSKYRRPRLRREEALIKVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRSGFKQRGKVSQELAGRKVGEHEDEDELQDEGTYSYYAYLAGNLLSPKTTNSIPTSWARPHGEIDLQLGLDAAPTKRDCLRPSKYRRPRLRREEALIKVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.44
4 0.39
5 0.34
6 0.33
7 0.28
8 0.23
9 0.2
10 0.21
11 0.2
12 0.2
13 0.21
14 0.19
15 0.17
16 0.14
17 0.12
18 0.1
19 0.06
20 0.07
21 0.06
22 0.05
23 0.05
24 0.05
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.08
37 0.08
38 0.1
39 0.12
40 0.13
41 0.16
42 0.18
43 0.21
44 0.2
45 0.26
46 0.26
47 0.24
48 0.25
49 0.24
50 0.23
51 0.19
52 0.2
53 0.15
54 0.13
55 0.11
56 0.1
57 0.08
58 0.07
59 0.08
60 0.06
61 0.09
62 0.1
63 0.12
64 0.17
65 0.22
66 0.25
67 0.33
68 0.42
69 0.49
70 0.59
71 0.68
72 0.74
73 0.8
74 0.88
75 0.89
76 0.91
77 0.91
78 0.92
79 0.89
80 0.87
81 0.86