Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C1CWY9

Protein Details
Accession A0A1C1CWY9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
161-183AIGDYYKKSKPTRRKLAILKDSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011339  ISCU  
IPR002871  NIF_FeS_clus_asmbl_NifU_N  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0005506  F:iron ion binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF01592  NifU_N  
CDD cd06664  IscU_like  
Amino Acid Sequences MSQRALLAIPRALRTSAQMSALRPSLASPSSTIRPAAAGLQQRRSYHEKVLDHYSNPRNVGSMDKKALDVGTGLVGAPACGDVMKLQIKVDPETQTIADVKFKTFGCGSAIASSSYLTELVRGMTLEQAGKIRNTEIAKELCLPPVKLHCSMLAEDAIKSAIGDYYKKSKPTRRKLAILKDSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.26
5 0.27
6 0.26
7 0.3
8 0.31
9 0.27
10 0.22
11 0.21
12 0.2
13 0.18
14 0.18
15 0.15
16 0.19
17 0.22
18 0.23
19 0.23
20 0.19
21 0.18
22 0.18
23 0.18
24 0.18
25 0.24
26 0.26
27 0.34
28 0.38
29 0.38
30 0.43
31 0.47
32 0.45
33 0.43
34 0.46
35 0.41
36 0.4
37 0.48
38 0.45
39 0.41
40 0.46
41 0.45
42 0.41
43 0.39
44 0.36
45 0.28
46 0.26
47 0.32
48 0.28
49 0.28
50 0.27
51 0.26
52 0.26
53 0.26
54 0.25
55 0.18
56 0.13
57 0.08
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.06
71 0.08
72 0.08
73 0.09
74 0.1
75 0.12
76 0.14
77 0.16
78 0.15
79 0.14
80 0.15
81 0.15
82 0.14
83 0.14
84 0.12
85 0.13
86 0.12
87 0.12
88 0.14
89 0.14
90 0.15
91 0.15
92 0.15
93 0.13
94 0.14
95 0.15
96 0.13
97 0.13
98 0.12
99 0.12
100 0.11
101 0.09
102 0.08
103 0.08
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.07
114 0.08
115 0.1
116 0.11
117 0.11
118 0.12
119 0.11
120 0.16
121 0.17
122 0.17
123 0.2
124 0.21
125 0.21
126 0.24
127 0.24
128 0.24
129 0.26
130 0.25
131 0.24
132 0.29
133 0.32
134 0.31
135 0.31
136 0.28
137 0.28
138 0.28
139 0.27
140 0.23
141 0.2
142 0.17
143 0.17
144 0.15
145 0.12
146 0.11
147 0.09
148 0.08
149 0.09
150 0.11
151 0.15
152 0.23
153 0.28
154 0.35
155 0.43
156 0.51
157 0.6
158 0.7
159 0.77
160 0.77
161 0.83
162 0.86
163 0.89