Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RYD6

Protein Details
Accession A0A1E4RYD6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MEPRKRNRKPVVCTVCRKRKIRVBasic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 11.833, cyto_nucl 4.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEPRKRNRKPVVCTVCRKRKIRVSLYPSHVPKILLRLFTVFKWLNSGWRRVHTFILKHYKMRVLTWVCFLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.84
4 0.8
5 0.77
6 0.76
7 0.76
8 0.75
9 0.74
10 0.71
11 0.71
12 0.74
13 0.73
14 0.66
15 0.58
16 0.5
17 0.41
18 0.34
19 0.32
20 0.28
21 0.21
22 0.19
23 0.2
24 0.2
25 0.19
26 0.24
27 0.18
28 0.15
29 0.19
30 0.19
31 0.25
32 0.26
33 0.32
34 0.29
35 0.34
36 0.39
37 0.36
38 0.42
39 0.4
40 0.4
41 0.44
42 0.52
43 0.49
44 0.48
45 0.49
46 0.5
47 0.45
48 0.44
49 0.44
50 0.39
51 0.39