Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RW03

Protein Details
Accession A0A1E4RW03    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
4-23GRTSQVRKTSQQTRRRQTFQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MELGRTSQVRKTSQQTRRRQTFQEGWACCYVQVFVCTGVCMYGCMDVRMYAQHRRIPIVVGDQILNKQQAINPKVFNCTHNACV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.76
4 0.8
5 0.8
6 0.76
7 0.74
8 0.72
9 0.7
10 0.68
11 0.59
12 0.53
13 0.5
14 0.45
15 0.36
16 0.29
17 0.21
18 0.13
19 0.12
20 0.09
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.06
27 0.06
28 0.05
29 0.07
30 0.07
31 0.08
32 0.08
33 0.08
34 0.09
35 0.12
36 0.14
37 0.17
38 0.21
39 0.24
40 0.25
41 0.27
42 0.27
43 0.25
44 0.24
45 0.22
46 0.2
47 0.18
48 0.18
49 0.17
50 0.18
51 0.19
52 0.18
53 0.14
54 0.13
55 0.14
56 0.23
57 0.25
58 0.29
59 0.31
60 0.32
61 0.38
62 0.39
63 0.38
64 0.36