Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H5C348

Protein Details
Accession A0A0H5C348    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
158-184YKDLKPFSPPSKHKKSKLERAVEKVRAHydrophilic
187-214LEAEKETKTKVKRGRKRPINVFKTKKILHydrophilic
NLS Segment(s)
PositionSequence
167-212PSKHKKSKLERAVEKVRAMELEAEKETKTKVKRGRKRPINVFKTKK
Subcellular Location(s) mito 16, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR014804  Pet20-like  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF08692  Pet20  
Amino Acid Sequences MLRTLFRPVSLTQTRSTLVQSARLQSTKTTSQTRNAKNALATKVAKQKKTNNLDYNALSNHNLQNPSKAENKVRVKKDYSALPRAPTTHHLNPQKLMIDSFYAGYRPLAMKSLQPNMDSRKKKASLFDLGIQDSAMWSYSAAGLEAFPEWDTIPYEEYKDLKPFSPPSKHKKSKLERAVEKVRAMELEAEKETKTKVKRGRKRPINVFKTKKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.33
4 0.3
5 0.25
6 0.3
7 0.32
8 0.34
9 0.38
10 0.38
11 0.37
12 0.34
13 0.38
14 0.36
15 0.39
16 0.41
17 0.39
18 0.47
19 0.56
20 0.61
21 0.63
22 0.59
23 0.56
24 0.52
25 0.55
26 0.49
27 0.46
28 0.41
29 0.39
30 0.46
31 0.5
32 0.51
33 0.51
34 0.57
35 0.61
36 0.68
37 0.72
38 0.69
39 0.67
40 0.65
41 0.6
42 0.55
43 0.46
44 0.39
45 0.3
46 0.26
47 0.24
48 0.24
49 0.26
50 0.23
51 0.27
52 0.27
53 0.29
54 0.32
55 0.32
56 0.32
57 0.39
58 0.49
59 0.52
60 0.55
61 0.57
62 0.55
63 0.55
64 0.56
65 0.54
66 0.51
67 0.5
68 0.47
69 0.44
70 0.41
71 0.38
72 0.36
73 0.33
74 0.34
75 0.31
76 0.37
77 0.41
78 0.41
79 0.41
80 0.41
81 0.38
82 0.31
83 0.25
84 0.18
85 0.13
86 0.12
87 0.11
88 0.09
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.11
98 0.14
99 0.19
100 0.2
101 0.2
102 0.23
103 0.28
104 0.37
105 0.37
106 0.36
107 0.4
108 0.41
109 0.42
110 0.44
111 0.43
112 0.4
113 0.4
114 0.42
115 0.36
116 0.33
117 0.31
118 0.27
119 0.21
120 0.14
121 0.12
122 0.07
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.06
136 0.06
137 0.07
138 0.08
139 0.08
140 0.1
141 0.1
142 0.12
143 0.14
144 0.16
145 0.18
146 0.21
147 0.22
148 0.21
149 0.25
150 0.29
151 0.35
152 0.43
153 0.49
154 0.54
155 0.64
156 0.72
157 0.76
158 0.81
159 0.83
160 0.83
161 0.85
162 0.86
163 0.82
164 0.82
165 0.83
166 0.78
167 0.7
168 0.6
169 0.51
170 0.41
171 0.35
172 0.32
173 0.25
174 0.24
175 0.24
176 0.24
177 0.23
178 0.24
179 0.25
180 0.26
181 0.28
182 0.33
183 0.41
184 0.51
185 0.61
186 0.71
187 0.8
188 0.83
189 0.89
190 0.92
191 0.93
192 0.92
193 0.93
194 0.9