Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S6Q0

Protein Details
Accession A0A1E4S6Q0    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MIKQNTNTKRKQGKQNKTLRQRCNVYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, mito 8, cyto_nucl 5.5, E.R. 4, golg 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIKQNTNTKRKQGKQNKTLRQRCNVYFRSRRDDIASFFSVCLFLQVLYHLIWVHWWRFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.89
3 0.89
4 0.89
5 0.9
6 0.86
7 0.83
8 0.79
9 0.74
10 0.73
11 0.68
12 0.66
13 0.64
14 0.62
15 0.61
16 0.56
17 0.52
18 0.47
19 0.44
20 0.37
21 0.34
22 0.32
23 0.25
24 0.23
25 0.22
26 0.18
27 0.15
28 0.14
29 0.08
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.09
36 0.08
37 0.08
38 0.12
39 0.16