Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4S0X9

Protein Details
Accession A0A1E4S0X9   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MSMRVVYSKKAKKSRKPTAEEKVKKPRDRNLRISCHydrophilic
73-100NQDVKQNKAKERAKKRKRNNLSNLLESKHydrophilic
NLS Segment(s)
PositionSequence
9-29KKAKKSRKPTAEEKVKKPRDR
80-91KAKERAKKRKRN
Subcellular Location(s) nucl 21.5, mito_nucl 13.666, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MSMRVVYSKKAKKSRKPTAEEKVKKPRDRNLRISCFTCNKTMSFELLKPTPPVVSKPVEKKPFVATWNPNQNNQDVKQNKAKERAKKRKRNNLSNLLESKKQAEEKEKKSNLLSLDDFMKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.87
5 0.87
6 0.89
7 0.86
8 0.85
9 0.85
10 0.85
11 0.85
12 0.81
13 0.79
14 0.79
15 0.8
16 0.8
17 0.8
18 0.79
19 0.75
20 0.71
21 0.68
22 0.63
23 0.57
24 0.5
25 0.41
26 0.33
27 0.33
28 0.32
29 0.28
30 0.25
31 0.24
32 0.24
33 0.23
34 0.24
35 0.2
36 0.2
37 0.18
38 0.16
39 0.17
40 0.16
41 0.19
42 0.22
43 0.28
44 0.36
45 0.39
46 0.39
47 0.39
48 0.39
49 0.39
50 0.36
51 0.36
52 0.32
53 0.35
54 0.45
55 0.45
56 0.45
57 0.42
58 0.42
59 0.4
60 0.37
61 0.39
62 0.3
63 0.33
64 0.38
65 0.43
66 0.46
67 0.52
68 0.57
69 0.58
70 0.67
71 0.74
72 0.77
73 0.82
74 0.87
75 0.89
76 0.92
77 0.93
78 0.92
79 0.91
80 0.86
81 0.84
82 0.8
83 0.72
84 0.65
85 0.55
86 0.48
87 0.42
88 0.4
89 0.36
90 0.41
91 0.46
92 0.51
93 0.61
94 0.62
95 0.61
96 0.58
97 0.59
98 0.51
99 0.48
100 0.41
101 0.33