Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RZE2

Protein Details
Accession A0A1E4RZE2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MISSSPVRPSPRKTTRKKKHASFPCRRRDPHAHydrophilic
NLS Segment(s)
PositionSequence
9-23PSPRKTTRKKKHASF
Subcellular Location(s) mito 10, plas 6, cyto 5, nucl 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MISSSPVRPSPRKTTRKKKHASFPCRRRDPHATLARKRYPSYQASPALVPRMAGTRNHGLVTAFVVHIVVCVCVCVPVCFYNSRHKRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.89
4 0.92
5 0.9
6 0.9
7 0.91
8 0.91
9 0.9
10 0.89
11 0.89
12 0.88
13 0.81
14 0.78
15 0.76
16 0.71
17 0.7
18 0.7
19 0.68
20 0.66
21 0.72
22 0.71
23 0.65
24 0.6
25 0.54
26 0.5
27 0.47
28 0.45
29 0.42
30 0.38
31 0.36
32 0.36
33 0.32
34 0.28
35 0.22
36 0.18
37 0.12
38 0.12
39 0.12
40 0.12
41 0.15
42 0.18
43 0.19
44 0.19
45 0.19
46 0.17
47 0.16
48 0.17
49 0.14
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.04
58 0.05
59 0.05
60 0.07
61 0.08
62 0.08
63 0.1
64 0.12
65 0.15
66 0.19
67 0.22
68 0.31
69 0.39