Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4S6K0

Protein Details
Accession A0A1E4S6K0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-45KLSDEEPKTPKRKNRRIQQNMDMLRSHydrophilic
NLS Segment(s)
PositionSequence
29-34PKRKNR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.833, mito_nucl 13.666
Family & Domain DBs
Amino Acid Sequences MSRVTRSQTSLIKNRNEEPKLSDEEPKTPKRKNRRIQQNMDMLRSKINRPAFKSRSVNGTPKKIDKKDASGGHYVERVQQWEPLITPNIEWISPELKPYIRSLYKFKMLKDMNLSLFTINLLKSDIGEMDQRDEHLAAMLHTQNSEIGADAEMDRKFYEHFGIQYDDTYPSSVMNKSITFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.63
4 0.57
5 0.53
6 0.51
7 0.5
8 0.47
9 0.48
10 0.41
11 0.47
12 0.52
13 0.56
14 0.58
15 0.59
16 0.66
17 0.7
18 0.78
19 0.8
20 0.83
21 0.85
22 0.88
23 0.89
24 0.88
25 0.87
26 0.81
27 0.76
28 0.68
29 0.57
30 0.52
31 0.46
32 0.39
33 0.36
34 0.39
35 0.4
36 0.43
37 0.53
38 0.5
39 0.56
40 0.6
41 0.54
42 0.55
43 0.54
44 0.57
45 0.52
46 0.56
47 0.51
48 0.55
49 0.61
50 0.56
51 0.58
52 0.53
53 0.53
54 0.54
55 0.54
56 0.49
57 0.45
58 0.43
59 0.37
60 0.34
61 0.28
62 0.23
63 0.2
64 0.18
65 0.14
66 0.15
67 0.15
68 0.14
69 0.14
70 0.13
71 0.13
72 0.11
73 0.1
74 0.11
75 0.11
76 0.1
77 0.09
78 0.09
79 0.1
80 0.1
81 0.1
82 0.1
83 0.1
84 0.11
85 0.13
86 0.18
87 0.19
88 0.21
89 0.26
90 0.29
91 0.36
92 0.38
93 0.37
94 0.4
95 0.37
96 0.38
97 0.38
98 0.38
99 0.31
100 0.3
101 0.3
102 0.21
103 0.2
104 0.17
105 0.13
106 0.09
107 0.08
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.1
115 0.1
116 0.12
117 0.12
118 0.13
119 0.13
120 0.13
121 0.12
122 0.11
123 0.11
124 0.08
125 0.11
126 0.13
127 0.12
128 0.12
129 0.12
130 0.11
131 0.11
132 0.11
133 0.08
134 0.07
135 0.07
136 0.08
137 0.08
138 0.12
139 0.12
140 0.13
141 0.12
142 0.12
143 0.13
144 0.13
145 0.17
146 0.15
147 0.17
148 0.19
149 0.23
150 0.23
151 0.23
152 0.23
153 0.22
154 0.2
155 0.2
156 0.17
157 0.14
158 0.17
159 0.17
160 0.18
161 0.19