Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S5G0

Protein Details
Accession A0A1E4S5G0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-30KELIRGRLVNKLKKHQRRDSYNCSDPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 8, E.R. 4, golg 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSVKELIRGRLVNKLKKHQRRDSYNCSDPTYVQLLHSILKDDSMFLKFMALILTMSAIISVLVYLIHVLIDDLLRGLKLWGIGGFISSSMITTIWNTAKMLLGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.73
4 0.81
5 0.82
6 0.83
7 0.86
8 0.87
9 0.87
10 0.85
11 0.82
12 0.76
13 0.69
14 0.6
15 0.5
16 0.44
17 0.37
18 0.28
19 0.21
20 0.2
21 0.17
22 0.17
23 0.17
24 0.15
25 0.11
26 0.12
27 0.11
28 0.1
29 0.11
30 0.1
31 0.1
32 0.08
33 0.09
34 0.07
35 0.08
36 0.07
37 0.06
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.07
80 0.12
81 0.13
82 0.14
83 0.15
84 0.15