Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H5C8V6

Protein Details
Accession A0A0H5C8V6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41STPNSFKNPNYKHPTRRVKPVKQLIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MTQATVDIHTVAEMNSTPNSFKNPNYKHPTRRVKPVKQLIVDEQKHLRAIAEKVKHEPVTYFAIEAPPSIKPVKKYCDITGLKGNYRSASSGIRYHNAEVYSIVKNMAQGVDQQYLGLRNANTVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.13
5 0.14
6 0.2
7 0.21
8 0.25
9 0.34
10 0.38
11 0.48
12 0.56
13 0.63
14 0.67
15 0.75
16 0.81
17 0.75
18 0.81
19 0.81
20 0.8
21 0.82
22 0.83
23 0.8
24 0.72
25 0.69
26 0.66
27 0.65
28 0.57
29 0.5
30 0.43
31 0.37
32 0.34
33 0.31
34 0.24
35 0.17
36 0.19
37 0.23
38 0.25
39 0.25
40 0.28
41 0.31
42 0.31
43 0.28
44 0.26
45 0.21
46 0.21
47 0.19
48 0.17
49 0.13
50 0.13
51 0.13
52 0.13
53 0.11
54 0.07
55 0.09
56 0.1
57 0.12
58 0.15
59 0.2
60 0.25
61 0.3
62 0.33
63 0.33
64 0.41
65 0.41
66 0.41
67 0.43
68 0.42
69 0.39
70 0.38
71 0.37
72 0.28
73 0.28
74 0.25
75 0.19
76 0.19
77 0.2
78 0.22
79 0.24
80 0.26
81 0.27
82 0.28
83 0.29
84 0.26
85 0.24
86 0.2
87 0.2
88 0.19
89 0.17
90 0.17
91 0.14
92 0.14
93 0.14
94 0.13
95 0.1
96 0.12
97 0.16
98 0.18
99 0.17
100 0.17
101 0.17
102 0.19
103 0.19
104 0.2
105 0.15
106 0.15