Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GAM9

Protein Details
Accession C1GAM9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
188-225AAEKVEKASRQQRKQRKNRSKKFRGTEKTTGPKKDKKKBasic
NLS Segment(s)
PositionSequence
189-225AEKVEKASRQQRKQRKNRSKKFRGTEKTTGPKKDKKK
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbn:PADG_04315  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVKNGSKKRNKLWETCGSSAGTGIAVLGLARNAVVGPSREPTSKHNHKILRHWISRTTATTDKPSSQPSSSRFIKADFSNACGSLLENSAIMADAPVTLRTRKFIRNPLLARKQIVVDILHPNRANISKDELRGKLSELYKSNKEQVSVFGLRTHYGGGKTTGFALIYDSTEALKKFEPRYRLVRIGAAEKVEKASRQQRKQRKNRSKKFRGTEKTTGPKKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.71
3 0.64
4 0.54
5 0.47
6 0.39
7 0.3
8 0.2
9 0.11
10 0.08
11 0.06
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.07
22 0.08
23 0.1
24 0.14
25 0.17
26 0.18
27 0.21
28 0.25
29 0.33
30 0.42
31 0.47
32 0.53
33 0.57
34 0.6
35 0.67
36 0.73
37 0.72
38 0.68
39 0.64
40 0.6
41 0.58
42 0.56
43 0.5
44 0.45
45 0.39
46 0.36
47 0.39
48 0.37
49 0.36
50 0.35
51 0.37
52 0.34
53 0.32
54 0.35
55 0.33
56 0.38
57 0.37
58 0.38
59 0.34
60 0.32
61 0.34
62 0.29
63 0.33
64 0.26
65 0.26
66 0.25
67 0.24
68 0.23
69 0.18
70 0.18
71 0.12
72 0.12
73 0.09
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.04
80 0.03
81 0.03
82 0.04
83 0.05
84 0.06
85 0.08
86 0.08
87 0.11
88 0.15
89 0.2
90 0.25
91 0.32
92 0.38
93 0.45
94 0.49
95 0.55
96 0.6
97 0.55
98 0.51
99 0.44
100 0.37
101 0.3
102 0.27
103 0.18
104 0.13
105 0.2
106 0.19
107 0.22
108 0.21
109 0.21
110 0.21
111 0.23
112 0.22
113 0.15
114 0.21
115 0.21
116 0.24
117 0.28
118 0.27
119 0.27
120 0.26
121 0.26
122 0.25
123 0.24
124 0.26
125 0.25
126 0.29
127 0.31
128 0.34
129 0.38
130 0.33
131 0.32
132 0.28
133 0.27
134 0.29
135 0.26
136 0.24
137 0.21
138 0.21
139 0.2
140 0.2
141 0.19
142 0.14
143 0.13
144 0.14
145 0.13
146 0.13
147 0.13
148 0.13
149 0.13
150 0.11
151 0.1
152 0.11
153 0.1
154 0.1
155 0.1
156 0.1
157 0.09
158 0.12
159 0.12
160 0.12
161 0.14
162 0.18
163 0.24
164 0.29
165 0.34
166 0.37
167 0.44
168 0.49
169 0.52
170 0.48
171 0.46
172 0.44
173 0.43
174 0.4
175 0.36
176 0.3
177 0.25
178 0.27
179 0.24
180 0.23
181 0.26
182 0.34
183 0.42
184 0.51
185 0.6
186 0.68
187 0.77
188 0.87
189 0.91
190 0.92
191 0.94
192 0.94
193 0.95
194 0.95
195 0.95
196 0.94
197 0.94
198 0.92
199 0.9
200 0.89
201 0.88
202 0.87
203 0.85
204 0.84
205 0.82