Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S4T2

Protein Details
Accession A0A1E4S4T2    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
322-343PPSYSQVKPGKHNKPLKFKSLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 10.5, cyto_nucl 8, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR014756  Ig_E-set  
Amino Acid Sequences MSYLRGVVSVKVNRSSVSLKEINVKFIGERVDVVFSREINRRLFTDIRNKIVDEMCSYTVEGHRLLKGTYTIPFQFMVDPTLPETVNTSLGSRNYRIEVHMDKQNSNNSPLKTPITMIRAPLDRSLVANDCVGAIGSWHSVMPYSVLVSSRVCQLGKPFDISVETQPNPMINCSGVVKSVRVLFVQKIKCPSSAPTEPYTLFNRQTLWMKSYGPPKDPYDPFRLETTIKIPQTLNFDVFPYTSNGENEDGSPAPELRISHYIYIQISMHPIFITEDEFIDDQPPLDEKIQIHTWDDVKDDLVFKAPVFLLHRNANEEHNLAPPSYSQVKPGKHNKPLKFKSLAWICSDGVYDDSRPPKYVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.32
4 0.34
5 0.33
6 0.3
7 0.39
8 0.4
9 0.4
10 0.37
11 0.35
12 0.28
13 0.27
14 0.29
15 0.2
16 0.2
17 0.18
18 0.21
19 0.21
20 0.24
21 0.23
22 0.2
23 0.25
24 0.3
25 0.33
26 0.32
27 0.34
28 0.32
29 0.36
30 0.4
31 0.41
32 0.46
33 0.47
34 0.49
35 0.49
36 0.48
37 0.46
38 0.44
39 0.39
40 0.32
41 0.3
42 0.26
43 0.24
44 0.24
45 0.22
46 0.21
47 0.22
48 0.2
49 0.18
50 0.18
51 0.19
52 0.18
53 0.18
54 0.18
55 0.18
56 0.18
57 0.21
58 0.2
59 0.21
60 0.21
61 0.2
62 0.2
63 0.18
64 0.19
65 0.15
66 0.15
67 0.15
68 0.17
69 0.16
70 0.14
71 0.16
72 0.14
73 0.15
74 0.15
75 0.14
76 0.15
77 0.18
78 0.22
79 0.21
80 0.21
81 0.21
82 0.22
83 0.22
84 0.25
85 0.26
86 0.27
87 0.31
88 0.32
89 0.31
90 0.34
91 0.4
92 0.37
93 0.38
94 0.39
95 0.35
96 0.35
97 0.36
98 0.34
99 0.28
100 0.28
101 0.27
102 0.27
103 0.26
104 0.25
105 0.26
106 0.26
107 0.27
108 0.27
109 0.24
110 0.18
111 0.18
112 0.19
113 0.17
114 0.15
115 0.14
116 0.13
117 0.11
118 0.1
119 0.09
120 0.06
121 0.05
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.05
131 0.05
132 0.06
133 0.07
134 0.08
135 0.09
136 0.09
137 0.11
138 0.13
139 0.12
140 0.12
141 0.15
142 0.19
143 0.19
144 0.2
145 0.18
146 0.16
147 0.18
148 0.19
149 0.19
150 0.2
151 0.19
152 0.17
153 0.18
154 0.18
155 0.17
156 0.16
157 0.13
158 0.07
159 0.08
160 0.08
161 0.08
162 0.09
163 0.09
164 0.09
165 0.09
166 0.11
167 0.11
168 0.1
169 0.11
170 0.12
171 0.19
172 0.21
173 0.22
174 0.25
175 0.26
176 0.27
177 0.26
178 0.27
179 0.27
180 0.28
181 0.29
182 0.27
183 0.28
184 0.28
185 0.3
186 0.31
187 0.27
188 0.24
189 0.22
190 0.21
191 0.21
192 0.25
193 0.24
194 0.22
195 0.21
196 0.21
197 0.25
198 0.32
199 0.32
200 0.31
201 0.33
202 0.34
203 0.4
204 0.41
205 0.42
206 0.41
207 0.4
208 0.39
209 0.37
210 0.36
211 0.28
212 0.27
213 0.27
214 0.27
215 0.24
216 0.24
217 0.23
218 0.23
219 0.29
220 0.29
221 0.26
222 0.2
223 0.2
224 0.19
225 0.19
226 0.17
227 0.13
228 0.13
229 0.13
230 0.12
231 0.14
232 0.14
233 0.14
234 0.14
235 0.14
236 0.13
237 0.12
238 0.13
239 0.11
240 0.1
241 0.11
242 0.11
243 0.13
244 0.17
245 0.18
246 0.18
247 0.19
248 0.21
249 0.2
250 0.21
251 0.18
252 0.14
253 0.15
254 0.14
255 0.14
256 0.11
257 0.11
258 0.1
259 0.1
260 0.11
261 0.09
262 0.09
263 0.11
264 0.11
265 0.11
266 0.11
267 0.11
268 0.09
269 0.09
270 0.1
271 0.11
272 0.11
273 0.14
274 0.14
275 0.19
276 0.23
277 0.24
278 0.25
279 0.26
280 0.27
281 0.25
282 0.26
283 0.21
284 0.18
285 0.18
286 0.17
287 0.15
288 0.16
289 0.15
290 0.14
291 0.17
292 0.16
293 0.18
294 0.21
295 0.24
296 0.26
297 0.32
298 0.34
299 0.34
300 0.36
301 0.35
302 0.33
303 0.31
304 0.27
305 0.26
306 0.25
307 0.21
308 0.2
309 0.18
310 0.21
311 0.26
312 0.25
313 0.27
314 0.34
315 0.39
316 0.48
317 0.58
318 0.62
319 0.66
320 0.76
321 0.78
322 0.81
323 0.83
324 0.81
325 0.78
326 0.69
327 0.69
328 0.69
329 0.63
330 0.56
331 0.54
332 0.46
333 0.41
334 0.4
335 0.3
336 0.24
337 0.23
338 0.2
339 0.23
340 0.29
341 0.3