Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4S9L9

Protein Details
Accession A0A1E4S9L9    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-36KKVTVEKKDDARRQTRRGPRRNAKGSPSREBasic
NLS Segment(s)
PositionSequence
13-34KKDDARRQTRRGPRRNAKGSPS
53-53R
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSEKEIKKVTVEKKDDARRQTRRGPRRNAKGSPSREETSDSPSSTKSSQRTRRARAPSSRKSTNREDTRLDELDDISKLIECVPEITLINSTNKAKIYKAEINNEQYKITIPTLKKSPLQLQSFPGKPSNMDVIRNFNAKVRAMDKSVKFYFNYLVNDYRHLQLPANDFKLYENSKNKPQLQVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.74
4 0.76
5 0.74
6 0.76
7 0.8
8 0.81
9 0.82
10 0.84
11 0.86
12 0.86
13 0.88
14 0.89
15 0.86
16 0.84
17 0.83
18 0.8
19 0.76
20 0.72
21 0.63
22 0.55
23 0.53
24 0.45
25 0.43
26 0.4
27 0.33
28 0.28
29 0.27
30 0.29
31 0.27
32 0.31
33 0.31
34 0.37
35 0.46
36 0.55
37 0.64
38 0.68
39 0.75
40 0.78
41 0.79
42 0.79
43 0.8
44 0.79
45 0.78
46 0.8
47 0.76
48 0.73
49 0.73
50 0.73
51 0.7
52 0.64
53 0.59
54 0.54
55 0.55
56 0.5
57 0.42
58 0.32
59 0.26
60 0.23
61 0.19
62 0.15
63 0.09
64 0.08
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.07
74 0.08
75 0.09
76 0.1
77 0.12
78 0.12
79 0.12
80 0.14
81 0.14
82 0.13
83 0.14
84 0.2
85 0.25
86 0.29
87 0.33
88 0.36
89 0.4
90 0.44
91 0.43
92 0.36
93 0.29
94 0.26
95 0.22
96 0.19
97 0.19
98 0.16
99 0.19
100 0.24
101 0.26
102 0.28
103 0.29
104 0.35
105 0.38
106 0.42
107 0.4
108 0.4
109 0.44
110 0.44
111 0.42
112 0.38
113 0.3
114 0.26
115 0.27
116 0.31
117 0.26
118 0.27
119 0.27
120 0.31
121 0.33
122 0.35
123 0.33
124 0.28
125 0.3
126 0.27
127 0.29
128 0.25
129 0.25
130 0.27
131 0.35
132 0.33
133 0.38
134 0.39
135 0.38
136 0.36
137 0.34
138 0.34
139 0.32
140 0.34
141 0.3
142 0.32
143 0.31
144 0.34
145 0.35
146 0.33
147 0.31
148 0.28
149 0.27
150 0.26
151 0.32
152 0.36
153 0.37
154 0.35
155 0.32
156 0.32
157 0.38
158 0.38
159 0.41
160 0.42
161 0.44
162 0.53
163 0.62
164 0.64