Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RXU7

Protein Details
Accession A0A1E4RXU7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
120-146DTLWKKDTSKTRSKSKRPLSDESPKKEHydrophilic
NLS Segment(s)
PositionSequence
129-154KTRSKSKRPLSDESPKKETKKRRSHP
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSEKKSKMSSNVLNMKFMKQAEIREEERQREDKESRLKDLSEWRTASSESLKKRLVSKNRQNPRMVGYQTVYEISNVGSPVVGRRTFNTGERKTKTKNLEDAAGGEGHNEQGDEDMVELDTLWKKDTSKTRSKSKRPLSDESPKKETKKRRSHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.53
3 0.48
4 0.41
5 0.37
6 0.3
7 0.32
8 0.32
9 0.36
10 0.38
11 0.42
12 0.47
13 0.46
14 0.5
15 0.52
16 0.48
17 0.5
18 0.48
19 0.47
20 0.52
21 0.51
22 0.5
23 0.47
24 0.45
25 0.42
26 0.49
27 0.46
28 0.43
29 0.4
30 0.36
31 0.35
32 0.35
33 0.32
34 0.29
35 0.3
36 0.27
37 0.32
38 0.33
39 0.33
40 0.4
41 0.46
42 0.5
43 0.55
44 0.62
45 0.67
46 0.74
47 0.78
48 0.73
49 0.66
50 0.6
51 0.56
52 0.46
53 0.38
54 0.3
55 0.24
56 0.23
57 0.22
58 0.18
59 0.1
60 0.1
61 0.08
62 0.08
63 0.07
64 0.06
65 0.05
66 0.05
67 0.06
68 0.1
69 0.1
70 0.1
71 0.11
72 0.16
73 0.18
74 0.23
75 0.32
76 0.34
77 0.41
78 0.44
79 0.48
80 0.47
81 0.53
82 0.54
83 0.5
84 0.51
85 0.45
86 0.44
87 0.4
88 0.37
89 0.31
90 0.25
91 0.19
92 0.13
93 0.11
94 0.08
95 0.08
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.07
107 0.1
108 0.1
109 0.11
110 0.13
111 0.14
112 0.21
113 0.31
114 0.36
115 0.44
116 0.51
117 0.61
118 0.7
119 0.79
120 0.83
121 0.84
122 0.87
123 0.83
124 0.85
125 0.82
126 0.82
127 0.82
128 0.79
129 0.77
130 0.73
131 0.73
132 0.74
133 0.77
134 0.77