Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RWK0

Protein Details
Accession A0A1E4RWK0   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-61QDLNMRPKRAIKRRTRTGCLTCRRRRIKCDERKPGCRNCEHydrophilic
69-88GYQRVKPTKQEIKKITRQMSHydrophilic
NLS Segment(s)
PositionSequence
33-33K
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004035  Endouclease-III_FeS-bd_BS  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00764  ENDONUCLEASE_III_1  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MLPDYYHQQMYQAAVPPSVNVQDLNMRPKRAIKRRTRTGCLTCRRRRIKCDERKPGCRNCEKSRICCAGYQRVKPTKQEIKKITRQMSVNTILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.21
4 0.21
5 0.19
6 0.16
7 0.11
8 0.11
9 0.17
10 0.2
11 0.28
12 0.3
13 0.3
14 0.3
15 0.38
16 0.47
17 0.5
18 0.57
19 0.59
20 0.66
21 0.75
22 0.82
23 0.81
24 0.79
25 0.77
26 0.76
27 0.76
28 0.76
29 0.73
30 0.75
31 0.78
32 0.75
33 0.73
34 0.74
35 0.75
36 0.75
37 0.79
38 0.8
39 0.78
40 0.83
41 0.84
42 0.81
43 0.79
44 0.77
45 0.74
46 0.7
47 0.72
48 0.67
49 0.66
50 0.66
51 0.63
52 0.55
53 0.51
54 0.49
55 0.49
56 0.52
57 0.52
58 0.53
59 0.56
60 0.58
61 0.59
62 0.64
63 0.64
64 0.64
65 0.69
66 0.69
67 0.7
68 0.76
69 0.81
70 0.78
71 0.74
72 0.69
73 0.64
74 0.61