Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H5C3F6

Protein Details
Accession A0A0H5C3F6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-31ASISHPKIVKKFTKKFKRHHSDRYARVAEHydrophilic
NLS Segment(s)
PositionSequence
12-22KKFTKKFKRHH
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASISHPKIVKKFTKKFKRHHSDRYARVAENWRKQKGIDSCVRRRFRGTIPQPKIGYRTNKKTRHMMPSGHKAFLVNNVKDLDLLLLHTKTYAAEISHSVSSKNRVEIVARAKALGLKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.76
3 0.82
4 0.86
5 0.89
6 0.9
7 0.89
8 0.9
9 0.9
10 0.89
11 0.87
12 0.87
13 0.8
14 0.69
15 0.66
16 0.65
17 0.63
18 0.63
19 0.63
20 0.56
21 0.52
22 0.52
23 0.55
24 0.51
25 0.49
26 0.48
27 0.49
28 0.55
29 0.64
30 0.68
31 0.61
32 0.58
33 0.55
34 0.52
35 0.54
36 0.54
37 0.55
38 0.57
39 0.62
40 0.6
41 0.57
42 0.55
43 0.5
44 0.5
45 0.46
46 0.51
47 0.55
48 0.6
49 0.63
50 0.66
51 0.66
52 0.64
53 0.61
54 0.57
55 0.53
56 0.56
57 0.55
58 0.48
59 0.43
60 0.35
61 0.31
62 0.34
63 0.35
64 0.25
65 0.25
66 0.25
67 0.25
68 0.24
69 0.24
70 0.15
71 0.08
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.09
80 0.09
81 0.07
82 0.08
83 0.1
84 0.12
85 0.15
86 0.15
87 0.15
88 0.16
89 0.22
90 0.23
91 0.24
92 0.23
93 0.22
94 0.24
95 0.29
96 0.34
97 0.34
98 0.32
99 0.3
100 0.29
101 0.3
102 0.29
103 0.27
104 0.21
105 0.2
106 0.29
107 0.37
108 0.42
109 0.41
110 0.43
111 0.42