Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RZK1

Protein Details
Accession A0A1E4RZK1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MEPARYKPRRRVICQMVRKEGMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, plas 8, cyto_mito 7.5, cyto 2.5, E.R. 2
Family & Domain DBs
Amino Acid Sequences MEPARYKPRRRVICQMVRKEGMCPGLEKKTKENGNKLWKNKKVPYPLQTVRTSPSKSIAPSPCSPSLSICCAISLVLPLASVLCLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.74
5 0.67
6 0.58
7 0.51
8 0.44
9 0.34
10 0.29
11 0.25
12 0.31
13 0.34
14 0.35
15 0.36
16 0.41
17 0.47
18 0.5
19 0.54
20 0.53
21 0.6
22 0.66
23 0.7
24 0.71
25 0.7
26 0.72
27 0.71
28 0.69
29 0.66
30 0.65
31 0.61
32 0.61
33 0.58
34 0.57
35 0.53
36 0.47
37 0.41
38 0.41
39 0.38
40 0.3
41 0.29
42 0.25
43 0.25
44 0.32
45 0.34
46 0.33
47 0.35
48 0.4
49 0.4
50 0.4
51 0.39
52 0.34
53 0.32
54 0.31
55 0.29
56 0.23
57 0.2
58 0.19
59 0.18
60 0.15
61 0.13
62 0.1
63 0.08
64 0.08
65 0.07
66 0.08