Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S207

Protein Details
Accession A0A1E4S207    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-43VKSQTPKVDKQEKPKKPKGRAYKRLLYTKRBasic
NLS Segment(s)
PositionSequence
13-37KVKSQTPKVDKQEKPKKPKGRAYKR
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVDKQEKPKKPKGRAYKRLLYTKRFINVTLINGKRRANPGPSSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.69
10 0.72
11 0.76
12 0.76
13 0.8
14 0.8
15 0.81
16 0.79
17 0.84
18 0.84
19 0.84
20 0.85
21 0.83
22 0.82
23 0.79
24 0.8
25 0.76
26 0.7
27 0.63
28 0.59
29 0.55
30 0.48
31 0.42
32 0.37
33 0.34
34 0.34
35 0.38
36 0.37
37 0.37
38 0.4
39 0.41
40 0.41
41 0.44
42 0.45
43 0.42
44 0.45