Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4S4M6

Protein Details
Accession A0A1E4S4M6    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
154-178VSTLKTGDSRRMKKKSKEEDDTDSYHydrophilic
NLS Segment(s)
PositionSequence
15-22KKRAEAAR
30-41KEHREKAIGKEK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013260  mRNA_splic_SYF2  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF08231  SYF2  
Amino Acid Sequences MSAEERLLKLKQLQKKRAEAARENRQELFKEHREKAIGKEKLRQLEEKQERSREELEKIRALERGEDYQRRKAWDYTIEENEKWDAKLERRAQNRENAGFKNYSQMAEQAYNKEISQITVDKDRYKLQKAKDGHGTSGVDFHNKPSKEAVDTLVSTLKTGDSRRMKKKSKEEDDTDSYINIKNKQFNEKLNRHYDKHINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.71
3 0.76
4 0.75
5 0.76
6 0.76
7 0.76
8 0.77
9 0.76
10 0.71
11 0.66
12 0.62
13 0.56
14 0.51
15 0.5
16 0.47
17 0.48
18 0.47
19 0.48
20 0.49
21 0.49
22 0.53
23 0.54
24 0.53
25 0.47
26 0.54
27 0.54
28 0.58
29 0.59
30 0.56
31 0.5
32 0.54
33 0.6
34 0.61
35 0.61
36 0.59
37 0.58
38 0.57
39 0.58
40 0.5
41 0.47
42 0.45
43 0.43
44 0.41
45 0.41
46 0.38
47 0.35
48 0.32
49 0.3
50 0.25
51 0.26
52 0.28
53 0.34
54 0.37
55 0.41
56 0.43
57 0.44
58 0.44
59 0.4
60 0.38
61 0.38
62 0.4
63 0.38
64 0.42
65 0.42
66 0.38
67 0.38
68 0.35
69 0.29
70 0.23
71 0.2
72 0.16
73 0.16
74 0.24
75 0.31
76 0.37
77 0.42
78 0.48
79 0.48
80 0.52
81 0.54
82 0.49
83 0.46
84 0.4
85 0.36
86 0.31
87 0.28
88 0.26
89 0.22
90 0.19
91 0.15
92 0.15
93 0.14
94 0.16
95 0.17
96 0.14
97 0.15
98 0.15
99 0.14
100 0.15
101 0.13
102 0.11
103 0.13
104 0.12
105 0.13
106 0.18
107 0.2
108 0.2
109 0.22
110 0.27
111 0.29
112 0.34
113 0.38
114 0.36
115 0.43
116 0.44
117 0.47
118 0.51
119 0.49
120 0.42
121 0.41
122 0.39
123 0.3
124 0.32
125 0.27
126 0.21
127 0.19
128 0.22
129 0.26
130 0.25
131 0.26
132 0.25
133 0.27
134 0.26
135 0.27
136 0.26
137 0.22
138 0.22
139 0.23
140 0.22
141 0.2
142 0.18
143 0.17
144 0.15
145 0.15
146 0.16
147 0.24
148 0.31
149 0.4
150 0.5
151 0.6
152 0.68
153 0.74
154 0.84
155 0.86
156 0.86
157 0.86
158 0.82
159 0.8
160 0.77
161 0.71
162 0.62
163 0.51
164 0.42
165 0.38
166 0.36
167 0.34
168 0.33
169 0.36
170 0.39
171 0.48
172 0.52
173 0.57
174 0.63
175 0.66
176 0.69
177 0.73
178 0.75
179 0.7
180 0.72