Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H5CAV3

Protein Details
Accession A0A0H5CAV3    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
23-43AGTSKLKKKIRDIERFITKKRBasic
82-106HMIRFFEKKKALRRYKKTKKEYDELBasic
NLS Segment(s)
PositionSequence
75-101KKLSKKYHMIRFFEKKKALRRYKKTKK
113-122KKEIKKSRKK
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MAPIRGKKRSNGTSIEVANVLGAGTSKLKKKIRDIERFITKKRDSLPADVLLENERALETLKVELKNAENVQRVKKLSKKYHMIRFFEKKKALRRYKKTKKEYDELVSSDAEKKEIKKSRKKLTHAETDLLYVVNFPRDVKYVALFPNEDGDEGELDDNKKRGAQQTSEIRNALKKEIEQMNKTNTLPISLEEVVEGSVVDKTPLASNFETTRVQELTKEEQEEEEDELFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.41
4 0.33
5 0.26
6 0.21
7 0.15
8 0.07
9 0.07
10 0.06
11 0.1
12 0.14
13 0.19
14 0.28
15 0.34
16 0.39
17 0.49
18 0.58
19 0.64
20 0.71
21 0.74
22 0.75
23 0.8
24 0.8
25 0.75
26 0.75
27 0.66
28 0.6
29 0.55
30 0.55
31 0.48
32 0.48
33 0.49
34 0.44
35 0.45
36 0.4
37 0.37
38 0.3
39 0.27
40 0.21
41 0.16
42 0.11
43 0.08
44 0.09
45 0.08
46 0.07
47 0.11
48 0.15
49 0.16
50 0.16
51 0.18
52 0.19
53 0.24
54 0.25
55 0.27
56 0.28
57 0.32
58 0.36
59 0.39
60 0.4
61 0.4
62 0.44
63 0.48
64 0.51
65 0.57
66 0.62
67 0.64
68 0.72
69 0.74
70 0.73
71 0.71
72 0.72
73 0.69
74 0.67
75 0.66
76 0.62
77 0.63
78 0.69
79 0.71
80 0.72
81 0.77
82 0.81
83 0.85
84 0.9
85 0.9
86 0.88
87 0.84
88 0.8
89 0.75
90 0.69
91 0.61
92 0.52
93 0.44
94 0.34
95 0.28
96 0.26
97 0.2
98 0.17
99 0.14
100 0.14
101 0.21
102 0.29
103 0.37
104 0.43
105 0.52
106 0.61
107 0.68
108 0.72
109 0.73
110 0.72
111 0.73
112 0.66
113 0.59
114 0.49
115 0.41
116 0.36
117 0.27
118 0.2
119 0.1
120 0.08
121 0.07
122 0.07
123 0.06
124 0.07
125 0.09
126 0.1
127 0.11
128 0.11
129 0.13
130 0.15
131 0.17
132 0.16
133 0.14
134 0.16
135 0.16
136 0.15
137 0.12
138 0.11
139 0.09
140 0.09
141 0.09
142 0.08
143 0.09
144 0.11
145 0.11
146 0.11
147 0.12
148 0.14
149 0.2
150 0.23
151 0.25
152 0.31
153 0.41
154 0.46
155 0.48
156 0.47
157 0.42
158 0.41
159 0.4
160 0.35
161 0.27
162 0.22
163 0.26
164 0.34
165 0.39
166 0.39
167 0.42
168 0.44
169 0.46
170 0.46
171 0.42
172 0.34
173 0.3
174 0.26
175 0.23
176 0.23
177 0.19
178 0.19
179 0.15
180 0.15
181 0.13
182 0.12
183 0.11
184 0.05
185 0.06
186 0.06
187 0.06
188 0.06
189 0.08
190 0.12
191 0.13
192 0.18
193 0.18
194 0.21
195 0.23
196 0.27
197 0.28
198 0.25
199 0.28
200 0.25
201 0.25
202 0.24
203 0.28
204 0.32
205 0.35
206 0.36
207 0.32
208 0.32
209 0.34
210 0.32
211 0.31