Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TIX4

Protein Details
Accession A7TIX4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKAHKDKAKHAVILHydrophilic
NLS Segment(s)
PositionSequence
11-37AKAAAAMAGGKKSKKKWSKKAHKDKAK
Subcellular Location(s) mito 15.5, mito_nucl 11.833, nucl 7, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG vpo:Kpol_526p20  -  
vpo:Kpol_541p29  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKAHKDKAKHAVILDQEKYDRILKEVPTFRYVSVSVLVDRLKIGGSLARVALRDLEKQGIIKAVSKHSKQAIYTRAVASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.17
4 0.14
5 0.15
6 0.17
7 0.21
8 0.25
9 0.3
10 0.39
11 0.48
12 0.57
13 0.64
14 0.73
15 0.81
16 0.87
17 0.93
18 0.94
19 0.94
20 0.9
21 0.89
22 0.88
23 0.81
24 0.72
25 0.61
26 0.54
27 0.48
28 0.47
29 0.38
30 0.28
31 0.24
32 0.22
33 0.24
34 0.22
35 0.18
36 0.14
37 0.16
38 0.16
39 0.23
40 0.27
41 0.27
42 0.27
43 0.28
44 0.26
45 0.25
46 0.24
47 0.17
48 0.14
49 0.13
50 0.11
51 0.12
52 0.12
53 0.1
54 0.1
55 0.09
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.14
67 0.14
68 0.16
69 0.16
70 0.18
71 0.18
72 0.18
73 0.19
74 0.19
75 0.18
76 0.2
77 0.22
78 0.28
79 0.35
80 0.36
81 0.42
82 0.44
83 0.47
84 0.46
85 0.5
86 0.48
87 0.45
88 0.48