Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RYW7

Protein Details
Accession A0A1E4RYW7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
170-198GSKGLTHSLKKLKRKKPSTNRSSKKQKKSBasic
NLS Segment(s)
PositionSequence
178-198LKKLKRKKPSTNRSSKKQKKS
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGADGSVKLKRKELVKESKGDKIDRIAQIEYNNERWTTCQLSNKPLRDPVVSDYKGLLYNKESILEYLVEPDNFNEKQRQNLSHIKSLKDVVALKTHNFKCPLSDKELGNGGINYVYLIPCGDCMAQKCLELNDTRQCPVCDLPYEDTIVINPTSSETVQELEKRMEILGSKGLTHSLKKLKRKKPSTNRSSKKQKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.66
4 0.66
5 0.69
6 0.68
7 0.6
8 0.53
9 0.48
10 0.5
11 0.45
12 0.45
13 0.38
14 0.36
15 0.36
16 0.4
17 0.38
18 0.34
19 0.32
20 0.28
21 0.27
22 0.26
23 0.28
24 0.27
25 0.28
26 0.33
27 0.34
28 0.44
29 0.52
30 0.53
31 0.52
32 0.51
33 0.5
34 0.43
35 0.42
36 0.37
37 0.38
38 0.36
39 0.32
40 0.28
41 0.27
42 0.3
43 0.27
44 0.24
45 0.17
46 0.19
47 0.19
48 0.2
49 0.18
50 0.14
51 0.15
52 0.14
53 0.12
54 0.12
55 0.13
56 0.12
57 0.11
58 0.12
59 0.16
60 0.15
61 0.17
62 0.2
63 0.2
64 0.26
65 0.3
66 0.32
67 0.33
68 0.41
69 0.44
70 0.44
71 0.46
72 0.41
73 0.38
74 0.37
75 0.31
76 0.26
77 0.24
78 0.17
79 0.2
80 0.19
81 0.19
82 0.27
83 0.27
84 0.28
85 0.28
86 0.27
87 0.26
88 0.3
89 0.32
90 0.29
91 0.32
92 0.28
93 0.28
94 0.31
95 0.27
96 0.23
97 0.2
98 0.14
99 0.1
100 0.09
101 0.08
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.06
111 0.09
112 0.12
113 0.13
114 0.13
115 0.14
116 0.14
117 0.16
118 0.16
119 0.18
120 0.23
121 0.24
122 0.25
123 0.27
124 0.27
125 0.27
126 0.27
127 0.26
128 0.21
129 0.23
130 0.25
131 0.23
132 0.24
133 0.22
134 0.2
135 0.17
136 0.17
137 0.13
138 0.1
139 0.08
140 0.08
141 0.1
142 0.1
143 0.11
144 0.1
145 0.11
146 0.14
147 0.17
148 0.18
149 0.18
150 0.19
151 0.18
152 0.17
153 0.17
154 0.15
155 0.14
156 0.17
157 0.16
158 0.16
159 0.16
160 0.2
161 0.21
162 0.22
163 0.28
164 0.33
165 0.4
166 0.51
167 0.61
168 0.66
169 0.75
170 0.84
171 0.87
172 0.89
173 0.92
174 0.92
175 0.93
176 0.93
177 0.93
178 0.94