Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S497

Protein Details
Accession A0A1E4S497    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSGAQRKLKTSRKKKDPNAPKRSLSAHydrophilic
NLS Segment(s)
PositionSequence
6-21RKLKTSRKKKDPNAPK
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSGAQRKLKTSRKKKDPNAPKRSLSAYMFFANENRDIVRAENPGISFGGVGKLLGEKWKALTPEGKVPYEQKAEADKKRYEQEKANYQAQQQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.93
4 0.93
5 0.92
6 0.88
7 0.8
8 0.74
9 0.68
10 0.62
11 0.53
12 0.45
13 0.38
14 0.32
15 0.3
16 0.26
17 0.23
18 0.19
19 0.18
20 0.15
21 0.12
22 0.11
23 0.11
24 0.12
25 0.14
26 0.13
27 0.13
28 0.14
29 0.13
30 0.13
31 0.13
32 0.11
33 0.08
34 0.07
35 0.07
36 0.05
37 0.05
38 0.04
39 0.05
40 0.05
41 0.07
42 0.08
43 0.07
44 0.09
45 0.12
46 0.13
47 0.14
48 0.18
49 0.18
50 0.26
51 0.3
52 0.29
53 0.28
54 0.29
55 0.33
56 0.33
57 0.31
58 0.25
59 0.31
60 0.38
61 0.43
62 0.48
63 0.46
64 0.48
65 0.56
66 0.58
67 0.55
68 0.56
69 0.58
70 0.61
71 0.64
72 0.66
73 0.6